KEGG   Renibacterium salmoninarum: RSal33209_0245Help
Entry
RSal33209_0245    CDS       T00641                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00020  Citrate cycle (TCA cycle)
rsa00480  Glutathione metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa01130  Biosynthesis of antibiotics
rsa01200  Carbon metabolism
rsa01210  2-Oxocarboxylic acid metabolism
rsa01230  Biosynthesis of amino acids
Module
rsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSal33209_0245
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RSal33209_0245
Enzymes [BR:rsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RSal33209_0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ABY22001
UniProt: A9WLT6
LinkDB All DBs
Position
207406..208659
Genome map
AA seq 417 aa AA seqDB search
MRRTVVSEGSVAYKIKVVGPVVELDGDEMTRIIWKFIKDRLIHPYLDIDLRYYDLSIQNR
DATDDQVTIDAANAIKEHHVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFR
EPIIISNIPRLVPGWNKPIIIGRHAFGDQYRATNFKVPGPGKLTMSFEPADGSEPMKFDV
VSYPEAGGVAMGMYNFTDSIKDFARASFAYGLQRNYPVYLSTKNTILKAYDGQFKDLFQE
IFDNEFKDQFDAAGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLG
LMTSVLMTPDGQTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLMHRGKIDNT
PEVIEFAETLEDVVIKTVESGKMTKDLALLVSQDQAFLTTEDFLAALDENLSARLAG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaactgtagtgtctgaaggttctgtagcgtacaaaatcaaggtagttggcccc
gtcgtcgaactcgacggcgatgaaatgactcgtatcatctggaagttcatcaaagaccgc
ctgattcacccgtaccttgacattgatctgcgttattacgatctgtctatccagaaccgg
gacgccaccgatgatcaggtgaccattgatgctgcgaacgccatcaaagagcaccacgtt
ggcgtcaagtgcgccacaatcaccccggacgaagcccgcgtagaagaattcggcttgaag
aaaatgtgggtttccccgaacgggaccatccgcaacatcttgggcggcgtcgtattccgc
gagccgatcatcatctctaacatcccgcgcctggtgccgggctggaacaagccgatcatc
attggtcggcacgctttcggtgatcagtaccgcgccaccaacttcaaggttcccggtccg
ggcaagctcaccatgagcttcgagccggcagatggctccgagccgatgaagtttgacgtc
gtcagctacccggaagcgggcggcgtggccatgggtatgtacaacttcaccgattcgatc
aaggactttgcccgggctagctttgcttacggtctgcagcgcaactacccggtgtacctc
tccaccaaaaacaccatcctgaaggcctacgacggccagttcaaggatctgttccaggag
atcttcgacaacgagttcaaggatcagttcgacgccgcaggtctgacctatgagcaccgc
ttgatcgatgacatggttgcctccgcgatgaagtgggagggcggctacgtctgggcttgt
aaaaattacgacggcgatgtgcagtcagacaccgtggcacagggcttcggctcactcggc
ttgatgacttcagtactgatgacaccggatggacagacggttgaagctgaggctgctcac
ggcactgtgacccgtcactaccgtcagcaccagcaaggtaagcccacctcgaccaacccg
atcgcgtcaatcttcgcttggactcgcggtctcatgcaccgcggcaagatcgataacacc
cccgaggtaatcgagtttgcggagacccttgaagacgtcgttatcaagactgtcgagtcc
ggcaaaatgaccaaggacctcgcgctcttggtcagccaggaccaggcgttcttgaccacc
gaggacttcttggcagctttggacgaaaacctttcggcacgcttggctggctaa

DBGET integrated database retrieval system