KEGG   Rhodoferax saidenbachensis: RS694_15535Help
Entry
RS694_15535       CDS       T04623                                 

Definition
(GenBank) serine--tRNA ligase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RS694_15535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rsb01007]
    RS694_15535
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsb03016]
    RS694_15535
Enzymes [BR:rsb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     RS694_15535
Amino acid related enzymes [BR:rsb01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   RS694_15535
Transfer RNA biogenesis [BR:rsb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RS694_15535
 Prokaryotic type
    RS694_15535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N CENP-H HIP1_clath_bdg
Motif
Other DBs
NCBI-ProteinID: APW43809
UniProt: A0A1P8KCT7
LinkDB All DBs
Position
complement(3256419..3257735)
Genome map
AA seq 438 aa AA seqDB search
MLDITLLRKDLDSVVARLQTRKNPQAFLNVDAFTALEAERKTIQMRTEELQSKRNTISKQ
IGMLKGKGQHAEADAAMAEVGSLKAELEASAARLDVIQAEMQNLLLAVPNLPHESVPVGA
DEHGNVVVRTWGTPKTYDFEVKDHVDLGNPLGLDFEMGVKLTGARFTVMKGQIARLHRAL
AQFMLDVQTTEHGYTECYTPYIVNGDTLRGTGQLPKFEEDLFAAKKGGQEGEAQPDHTAL
YLIPTSEVSLTNFVRDVVSAETDLPIKLTAHTPCFRSEAGSAGRDTRGLIRQHQFDKVEM
VQIVHPEKSYEALESMVTHAEAILQKLGLPYRVMSLCTGDMGFGASKTYDLEVWLPAQNT
FREISSVSNCEAFQARRLQARFKNAQGKNELVHTLNGSGLAVGRALVAVLENCQNADGSI
TVPEVLRPYMGGLAVLKA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgttagacatcaccctgctgcgcaaagacctggattcggtcgttgcccgtttgcaaacc
cgcaagaacccgcaagccttcctgaacgtggacgccttcacagcgttggaagccgagcgc
aagaccatccagatgcgcaccgaagagctgcagagcaagcgcaacaccatcagcaaacaa
attggcatgctcaagggcaaaggccaacatgccgaagccgacgccgccatggccgaagtg
ggcagcctgaaggccgagctggaagcttctgcggcacgtctggatgtgatccaggccgaa
atgcagaatctgctgctggccgtgcccaacctgccgcatgaaagcgtgcccgtaggagcc
gacgagcacggcaacgtcgtggtgcgcacctggggtacgcccaagacctatgactttgaa
gtcaaagaccacgtcgatctgggcaacccgctggggctggatttcgaaatgggcgtcaag
ctcaccggcgcacgtttcacggtgatgaagggccagatcgcccgtctgcaccgtgcactc
gcccagttcatgctggacgtgcaaaccaccgagcacggctacaccgagtgctacacgccg
tatatcgttaatggagacaccctgcgcggtaccggccagttgcccaagtttgaagaagac
ctgtttgccgccaagaagggcgggcaagagggcgaggcgcagccggaccacaccgcgctg
tacctgatcccgaccagcgaggtctcgctgaccaactttgtgcgtgatgtggtctctgcc
gagaccgatttgccgatcaagctcaccgcccacaccccgtgcttccgctcggaagccggc
agcgccgggcgcgatacgcgtggcctgatccgccagcaccagttcgacaaggtggaaatg
gtgcagatcgtgcaccccgagaagagctacgaggcgctggagtccatggtcacccatgcc
gaggcgatcctgcaaaagctcggcttgccgtaccgcgtgatgagcctgtgcaccggcgac
atgggttttggcgccagcaagacctatgacctggaagtgtggctgcccgcgcagaacact
ttccgcgagatcagctcggtctccaactgcgaagccttccaggcgcgccgcctgcaggcc
cgtttcaagaacgcccagggcaagaacgaactggtgcacacgctcaatggctccggcctg
gccgtgggccgcgcattggtggcggtgctagagaactgccagaacgccgacggctcgatt
accgtgcccgaagtgctgcgcccgtacatgggcggattggctgtcctgaaggcctga

DBGET integrated database retrieval system