KEGG   Rhodoferax saidenbachensis: RS694_16360Help
Entry
RS694_16360       CDS       T04623                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00550  Peptidoglycan biosynthesis
rsb01100  Metabolic pathways
rsb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RS694_16360
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RS694_16360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rsb01003]
    RS694_16360
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rsb01011]
    RS694_16360
Enzymes [BR:rsb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     RS694_16360
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RS694_16360
Glycosyltransferases [BR:rsb01003]
 Polysaccharide
  Bacterial polysaccharide
   RS694_16360
Peptidoglycan biosynthesis and degradation proteins [BR:rsb01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   RS694_16360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: APW43951
UniProt: A0A1P8KD69
LinkDB All DBs
Position
3423735..3426104
Genome map
AA seq 789 aa AA seqDB search
MPSNTEKSDSKAGGAQTPMHWLLRLALWAVGLAVAGALSLAMAIALALAVAFPNLPDISD
LSDYRPKLPLRVFSAEGDLLGEFGEERRNLTPIKEIPKVMSNAVLAIEDARFYQHGGVDY
VGVVRAGLANVGRVKSQGASTITMQVARNVYLTSEKTFTRKIYEILLTFKLEHMLTKDQI
LEIYMNQIFLGNRAYGFAAASEAYFGKPLKDVTIAEAAMLAGLPKAPSAYNPISNPKRAR
SRQLYIIDRMRENGFITDEEAEAAKKEELKVKNGTHTTQVHAEYATEMVRQLMYAQYGDE
TYTRGLDVRTTIRSADQDAAYKALRRGIMDFERRQIYRGPEKFITLPTNAQEAEDAIDEA
LDERPDNGDVMSAVVLEADAKKIKAVRQNGETVEITGDGLKPAQSGLSDKAPPNIKIRRG
AVIRVSKTTKGTWEITQLPEVEGAFVAIDPRDGSIKALVGGFDFAKNKFNHVTQAWRQPG
SSFKPFIYSAALEKGFTPSTVVNDAPLFFDAGVTGGQPWEPKNYDGTFEGPMTLRRGLAK
SKNMISIQILQSIGPQYAQDWITRFGFDADKHPPYLTMALGAGSVTPMQMATAYSVFANG
GYRVNPWLVTKVSEQRGKVLVETKAPVLTDSEPAIDARNAFMMSSLLQEVTRSGTAARAQ
AILKRPDIYGKTGTTNDSMDAWFAGYQQTLTAVTWIGYDTPHKLGDRETGGGLSLPVWIS
FMESALKNVPVSEPSAPEGVVRVGGEWYYDEFAKGGGVTGLGLDEQPEAATLPLPPADEK
KKILDLFKN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgccctccaataccgaaaaatctgactccaaggcgggaggcgcgcagacgcccatgcat
tggctactacgactagcgctctgggccgtcgggctggccgtcgctggggcactgtctttg
gccatggcgatcgcactggcgttggccgtggcgtttcccaacttgccggatatctccgat
ctctcggattaccgccccaagctgcctttgcgcgtgttttctgcggaaggcgacctactg
ggtgagtttggtgaagaacggcgcaacctgacgcccatcaaggaaatccccaaggtcatg
tccaacgccgtgctggccattgaagacgcccgcttctaccagcacggtggagtggactat
gtaggtgttgtgcgcgcgggcctggccaacgtgggccgggtcaaaagccagggcgcctcc
accatcaccatgcaggtggcgcgcaacgtctacctgacttccgagaaaacctttacccgc
aagatttacgaaatcctgctgacattcaagctggaacacatgttgaccaaggaccagatc
cttgagatctacatgaaccagatctttctgggcaaccgggcctatggttttgccgccgcc
tcggaagcgtatttcggcaaacccctgaaagacgtcactatcgcggaagcggccatgctg
gccggcctgcccaaagcgccatctgcctacaacccgatcagcaaccccaaacgcgcccgg
tcgcgccagttgtacatcatcgaccgcatgcgggaaaacggatttatcactgacgaggaa
gcggaagcggcgaagaaggaagagctcaaggtcaaaaacggtacccacacaacccaagtg
catgccgagtacgcgaccgaaatggtgcgccagctcatgtacgcgcagtacggggacgaa
acctacacccgcggactggacgtgcgaaccaccatccgcagtgcagaccaggacgccgct
tacaaggccttgcgccgcggcatcatggactttgagcgtcgccagatttaccggggtccc
gagaaattcatcacgctgcccaccaatgcccaagaggcggaagacgcgattgacgaagca
ttggacgagcgccccgacaacggcgacgtgatgtccgccgtggttctggaagccgacgcc
aagaagatcaaggctgtacggcaaaacggcgaaaccgttgaaatcactggcgatggcctc
aaaccagcgcagtctggcttgtctgacaaagcccctcccaacatcaagatccgacgtggc
gccgtgatccgggtttccaaaaccaccaaaggaacctgggaaatcacccaattgcctgaa
gtggaaggtgcgtttgtagcgatcgacccacgcgatggttccatcaaggcactggtgggt
ggttttgactttgccaaaaacaagttcaaccacgtgacacaagcctggcgccagccgggt
tccagcttcaagcctttcatttattctgcggcgctggaaaaaggcttcactccctccact
gtggtgaatgatgccccgctgttctttgatgccggcgtgacgggcggacagccgtgggaa
ccgaaaaactacgacggtaccttcgaaggcccaatgaccttgcgccgcggcctggccaag
tccaagaacatgatctccatccagatcctgcaatcgattggcccccaatacgcacaagac
tggatcacgcggtttggttttgacgccgacaaacacccgccctacctcaccatggcgctg
ggcgctggctccgtaactccgatgcagatggccaccgcgtattccgtgtttgccaacggc
ggttaccgcgtcaacccctggctggtgaccaaggtgagcgagcagcgcggcaaggtgttg
gtcgaaacaaaggctccggtactgacggactccgagcccgccattgacgcccgcaatgcc
ttcatgatgtccagcctgctgcaagaggttacccgttcaggtacggctgcgcgagcgcaa
gccatcctgaagcggccggacatttatggcaagaccggtacaaccaacgactccatggac
gcctggtttgccggttatcagcagacattgactgcggtgacctggattggctacgacacg
ccgcacaaactcggcgaccgtgaaaccggtggcggcttgagcttgcccgtgtggatcagc
ttcatggaaagcgcactcaaaaacgtacctgtctctgaaccgtccgcccccgaaggggtg
gtgcgcgtgggcggtgagtggtattacgacgaattcgccaaaggtggcggagtgacaggc
ttgggactggatgagcaaccggaggcggcgacgttgccgctaccaccagccgatgaaaag
aaaaaaatcctggatctgttcaagaactga

DBGET integrated database retrieval system