KEGG   Ralstonia solanacearum FQY_4: F504_1963Help
Entry
F504_1963         CDS       T02751                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rse00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    F504_1963
Enzymes [BR:rse01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     F504_1963
Transporters [BR:rse02000]
 Other Transporters
  Pores ion channels [TC:1]
   F504_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AGH84477
UniProt: M4UH22
LinkDB All DBs
Position
complement(2128097..2128753)
Genome map
AA seq 218 aa AA seqDB search
MLKLYGFAASNYYNKVKLALMEKGIPFEEALRWPDQTDGDLSPLHKVPYMVGEDGGMCES
QVIVDYLEARYPQPPLMPADPFQAAKVREIITFLELHLELVARQLYPEAFFGGKISDNFK
ARVREQLQKNIPATARLLKFAPYVAGDTFTIADCAAIVHFPLISSATKIIYGEDLLAPIE
GLKPYLARMGEMPNVQRVNAERKVNTEQMLAYYAGKRQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagctgtacggctttgccgcgagcaactactacaacaaggtcaagctcgcgctg
atggagaagggcattcccttcgaggaagcgctgcgctggcctgaccagaccgacggcgac
ctctcgccgctgcacaaggtgccttacatggtgggcgaagacggggggatgtgcgaatcg
caggtcatcgtcgattacctcgaggcgcgctatccgcagcctccgctgatgccggccgac
ccgttccaggcggccaaggtgcgcgagatcatcaccttcctggagctgcacctggagctg
gtggcgcgccagctgtatccggaggcgttcttcggcggcaagatcagcgacaacttcaag
gcccgggtgcgcgagcaactgcagaagaacatccccgcgacggcccggctgctgaagttc
gcaccctatgtggcgggcgacaccttcacgatcgcggattgcgcggccatcgtgcacttc
ccgctgatcagctcggccaccaagatcatctacggcgaagacctgctcgcgcccatcgag
ggcctcaagccgtaccttgccaggatgggcgagatgcccaacgtgcagcgcgtgaacgcc
gagcgcaaggtgaacaccgagcagatgctcgcgtactacgccggcaagcgccagtaa

DBGET integrated database retrieval system