KEGG   Ralstonia solanacearum PSI07: RPSI07_0456Help
Entry
RPSI07_0456       CDS       T01273                                 

Gene name
tufB
Definition
(GenBank) protein chain elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
rsl  Ralstonia solanacearum PSI07
Brite
KEGG Orthology (KO) [BR:rsl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rsl03012]
    RPSI07_0456 (tufB)
   03029 Mitochondrial biogenesis [BR:rsl03029]
    RPSI07_0456 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsl04147]
    RPSI07_0456 (tufB)
Translation factors [BR:rsl03012]
 Eukaryotic Type
  Elongation factors
   RPSI07_0456 (tufB)
 Prokaryotic Type
   RPSI07_0456 (tufB)
Mitochondrial biogenesis [BR:rsl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RPSI07_0456 (tufB)
Exosome [BR:rsl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RPSI07_0456 (tufB)
  Exosomal proteins of breast cancer cells
   RPSI07_0456 (tufB)
  Exosomal proteins of colorectal cancer cells
   RPSI07_0456 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CBJ49824
LinkDB All DBs
Position
446552..447742
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYEFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDSYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVIK
VGEEIEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggaccaagccgcacgtgaacgttgggacgatcggtcac
gttgaccacggcaagacgacgctgacggcagcaatcgcgacggtgctgtcgagcaagttc
ggtggcgaagcgaagaagtacgacgaaatcgacgcagcgccggaagaaaaggcacgcggc
atcacgatcaacaccgcgcacatcgagtacgaaacggccaaccgccactacgcgcacgtt
gactgcccgggccacgccgactacgtcaagaacatgatcaccggtgccgcccagatggac
ggcgcgattctggtggtctccgccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcccgccaggtgggcgtgccgtacatcatcgtcttcctgaacaagtgcgacatg
gtggacgacgccgagctgctcgagctggtcgaaatggaagtgcgcgaactgctctcgaag
tacgagttccccggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggccatcatgaacctggccgacgccctggactcg
tacatcccgacgccggagcgcgccgttgatggcacgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggtcgtatcgagcgcggcgtgatcaag
gtcggcgaagaaatcgaaatcgtcggcatcaaggccacgcaaaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccaaggtcaggctggcgacaacgtcggtatcctg
ctgcgcggcaccaagcgtgaagacgtcgagcgtggccaggtgctgtgcaagccgggttcg
atcaagccgcacacgcacttcaccggcgaggtgtacattctgtcgaaggacgaaggtggt
cgtcacaccccgttcttcaacaactaccgcccgcagttctacttccgtaccacggacgtg
accggctcgatcgaactgccggcaggcaaggaaatggtcatgcctggcgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaagaaggcctgcgtttcgccatccgt
gaaggcggtcgtaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system