KEGG   Ralstonia solanacearum PSI07: RPSI07_1386Help
Entry
RPSI07_1386       CDS       T01273                                 

Definition
(GenBank) putative dehydratase, MaoC-like domain
Organism
rsl  Ralstonia solanacearum PSI07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N
Motif
Other DBs
NCBI-ProteinID: CBJ50747
LinkDB All DBs
Position
1420020..1420490
Genome map
AA seq 156 aa AA seqDB search
MAEATLPYAFYFDDFEVGHTMEMGTYTVTEDEILTFARQYDPQPFHVDPEAARRSIYGGL
ISSGWMTCAVMMRLMVQRFLSKAASMGSPGVDEIRWLKPVYPGDTLSVSSTCLEVRPSQS
KPDRGVAVNRWEARNQRGELVCTLVGMGMFGRRPAA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagccacactaccgtacgcgttctacttcgacgacttcgaagtcggccacacg
atggagatgggcacctacacggtgaccgaggacgagatcctgaccttcgcccggcagtac
gacccgcaacccttccatgtcgacccggaggcggcccggcgcagcatctacggcggcctc
atctccagcggctggatgacctgcgcggtgatgatgcggctgatggtgcagcgcttcctc
agcaaggcggccagcatggggtcgccgggcgtggacgagatccgctggctcaagccggtg
tatccgggcgatacgctgtcggtgtcgagcacctgcctggaggtgcggccgtcgcagtcc
aagcccgaccgtggcgtggcggtcaaccgctgggaggcgcgcaaccagcgcggcgagctg
gtctgcaccctggtcggcatgggcatgttcggccgccgtccggcagcctga

DBGET integrated database retrieval system