Rhodovulum sulfidophilum: NHU_03430 Help Entry NHU_03430         CDS       T04143                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism rsu  Rhodovulum sulfidophilum Pathway rsu00400   Phenylalanine, tyrosine and tryptophan biosynthesis rsu01100   Metabolic pathways rsu01110   Biosynthesis of secondary metabolites rsu01230   Biosynthesis of amino acids Module rsu_M00024   Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine rsu_M00040   Tyrosine biosynthesis, chorismate => arogenate => tyrosine Brite KEGG Orthology (KO) [BR:rsu00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     NHU_03430 Enzymes [BR:rsu01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      NHU_03430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  BAQ70564 UniProt:  A0A0D6B754 LinkDB All DBs Position 3581981..3582277 Genome browser AA seq 98 aa AA seqDB search MTDDASRAAELLKEHRASIDRLDAILVYTLGERFKHTQAVGRLKAAHGLAPSDPAREDQQ IARLEDLAHQADLDPEFAKKFLNFIIQEVIRHHIEHQK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt ttgactgacgacgcaagccgtgccgccgagcttctcaaggagcaccgggccagcatcgac aggctcgacgccatcctcgtctacaccctgggcgagcggttcaagcacacccaggcggtg ggacggctgaaggccgcccatggcctcgcgccctcggacccggcccgcgaggaccagcag atcgcgcggctcgaggatctggctcaccaggccgatctcgatccggaattcgccaagaaa ttcctgaacttcatcattcaggaagtcatccgtcaccacatcgaacaccagaaatag

DBGET integrated database retrieval system