KEGG   Sulfolobus acidocaldarius N8: SacN8_00280Help
Entry
SacN8_00280       CDS       T02452                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sacn  Sulfolobus acidocaldarius N8
Pathway
sacn00620  Pyruvate metabolism
sacn00680  Methane metabolism
sacn00720  Carbon fixation pathways in prokaryotes
sacn01100  Metabolic pathways
sacn01120  Microbial metabolism in diverse environments
sacn01200  Carbon metabolism
Module
sacn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SacN8_00280
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SacN8_00280
   00680 Methane metabolism
    SacN8_00280
Enzymes [BR:sacn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SacN8_00280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGE70037
UniProt: M1IM24
LinkDB All DBs
Position
44258..45793
Genome map
AA seq 511 aa AA seqDB search
MRKIPRTMSTQHPDNAKVPEWNQGEAISGENEIIEAYLAFSRYGVEEVMWDAEGKDVDTH
VVRKLLSQYPEFFRHRILGKDIFLTYRVPNPKIEGAERKVFAETLNTIPITYDLAEKFYG
ENPNPPVFEVILPFTTSYEELIAVIKFYEKVIVNSDNTKLVDDTYVKDIIGETNPKKIEV
IPLIEDRDSMLRIDTIVGKYIEIERPPYLRVFLARSDPAMNYGLLSAVLSVKYALSRLSK
MEKIYGVKIFPLLGVGSLPFRGHFSPYNVENTLNEYRGIYTFTVQSAFKYDYEDDLVISA
IKKVNGTNVTEKIELSEEDEEIISNVTRKYTQGYQNKIEALADVINKVALLLPRRRARKL
HIGLFGYSRSTGKVTLPRAISFVGSLYTIGIPPEIIGLSSLSKMTDQELNAIFNNYKYLK
NDLQFAARFVNFEALQLLKDIWNIDAEVVKAIKEDIDYAENSLGIRIGESDYMSKKHVLL
STLALLSIKEGKLDEAKTYIKEMAIVRRAIG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatacctaggactatgtcaacacagcatcctgataacgcaaaagttcctgag
tggaaccaaggagaagcaataagcggtgaaaacgagatcatcgaggcatatttggctttc
tccaggtatggtgtggaggaggtaatgtgggatgctgaaggtaaggacgtggacactcat
gtagtgagaaaattactaagtcaatacccagaatttttcagacataggatattaggcaag
gatattttcctgacgtatagggttccaaatccaaaaatagagggtgctgagagaaaagtc
tttgctgaaacgctaaatactataccaataacatatgacttagctgagaagttttacggc
gaaaatcctaatccaccagtctttgaagttattttaccttttacaactagttatgaagag
ttaattgcagtcatcaagttttatgagaaagtaatagttaacagtgacaatacgaagcta
gttgatgatacttatgtaaaggatattataggtgagacaaatcctaagaagatcgaagta
attcctctaatagaagatagagattcaatgttaagaatagatacaatagttgggaaatac
atagaaatagagagacctccatatctgagagtattcttagcaagatcagatccagctatg
aattacggtttattgtcagctgttctgtcagtcaaatatgcattaagtagactttcgaaa
atggaaaagatttatggagtgaaaatatttcctttacttggagtcggttctttacccttc
aggggtcattttagtccatataatgttgaaaataccttgaatgaatatagaggcatatat
acctttactgttcaatcagcgttcaaatatgactatgaagatgaccttgtgatcagtgca
ataaagaaagtaaatgggactaacgtaaccgaaaaaattgaattaagtgaggaagatgag
gagatcatttccaacgtaacgagaaaatacacgcaaggttatcagaataagatagaggca
ttagccgatgttataaacaaagtggcattactgcttcctagaagaagagcaaggaaatta
cacataggtttgtttggatattctagaagcacaggtaaggtaacactacctagagctatt
tcctttgttggctctctttatactataggtattccacctgagattataggactttcctct
ctatcaaaaatgactgatcaagaacttaatgccatattcaataattacaagtatttgaag
aacgatctgcaattcgcagctcgtttcgttaactttgaagctcttcaattacttaaagat
atatggaatattgatgcagaggttgtcaaagctataaaggaagatatagactacgcagaa
aatagtttgggaattagaataggcgaaagtgattatatgagcaaaaaacacgttctactc
tctaccctggcactattgtccataaaagagggtaaattggacgaggctaaaacgtatata
aaagaaatggctatagtaagaagagcaataggatga

DBGET integrated database retrieval system