KEGG   Streptococcus agalactiae ILRI005: MSA_1910Help
Entry
MSA_1910          CDS       T02704                                 

Definition
(GenBank) Fructose-bisphosphate aldolase class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00010  Glycolysis / Gluconeogenesis
sagi00030  Pentose phosphate pathway
sagi00051  Fructose and mannose metabolism
sagi00680  Methane metabolism
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
sagi01230  Biosynthesis of amino acids
Module
sagi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSA_1910
   00030 Pentose phosphate pathway
    MSA_1910
   00051 Fructose and mannose metabolism
    MSA_1910
  09102 Energy metabolism
   00680 Methane metabolism
    MSA_1910
Enzymes [BR:sagi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MSA_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase CutC ThiG Radical_SAM
Motif
Other DBs
NCBI-ProteinID: CCW39089
LinkDB All DBs
Position
138936..139817
Genome map
AA seq 293 aa AA seqDB search
MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPVLIQTSMGAAKYMGGY
KLCKQLIETLVESMGITVPVAIHLDHGHYDDALECIEVGYTSIMFDGSHLPVEENLEKAR
EVVAKAHAKGISVEAEVGTIGGEEDGIVGKGELAPIEDAKAMVETGIDFLAAGIGNIHGP
YPANWEGLDLDHLKKLTEAVPGFPIVLHGGSGIPDDQIQEAIKLGVAKVNVNTECQLAFC
QATRDYAVEFNANEAEYMKKKLFDPRKFLKPGFDAITEAVEERIDVFGSANKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtttcagcagaaaaattcgtccaagcagctcgtgataacggctatgcagta
ggtggatttaacacaaacaaccttgagtggactcaagctatcttgcgcgcagcagaagct
aaaaaagctccagtacttatccaaacttcaatgggtgcggctaaatacatgggtggttac
aaactttgtaaacaacttattgaaactttggttgaatcaatgggtattactgtaccagtt
gctatccaccttgaccacggtcattacgatgatgcccttgagtgtattgaagtaggttac
acttcaattatgtttgatggttcacaccttccagttgaagaaaaccttgaaaaagcacgc
gaagttgttgctaaagcacatgctaaaggtatttcagtagaagctgaagttggtactatc
ggtggtgaagaagatggtattgttggtaaaggtgaattagcaccaatcgaagatgctaaa
gctatggttgaaactggtattgacttcttggctgcaggtatcggtaacattcatgggcca
tacccagcaaactgggaaggacttgaccttgatcacttgaagaaattgactgaagctgtt
cctggtttcccaatcgtgttacacggtggttcaggtattcctgatgatcaaatccaagaa
gctatcaaacttggtgttgctaaagttaacgttaacacagaatgtcaattagctttctgt
caagcaactcgtgactacgctgttgaattcaacgctaacgaagctgaatacatgaagaaa
aaactctttgacccacgtaaattcttgaaacctggtttcgatgcaattacagaagcagtt
gaagaacgtattgacgtgtttggttcagcaaacaaagcataa

DBGET integrated database retrieval system