KEGG   Streptococcus agalactiae ILRI005: MSA_2660Help
Entry
MSA_2660          CDS       T02704                                 

Definition
(GenBank) Transketolase, N-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
sagi01230  Biosynthesis of amino acids
Module
sagi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_2660
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    MSA_2660
Enzymes [BR:sagi01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     MSA_2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh TPP_enzyme_C XFP_N
Motif
Other DBs
NCBI-ProteinID: CCW39159
LinkDB All DBs
Position
219030..219887
Genome map
AA seq 285 aa AA seqDB search
MTSPEERYSSLRRFATEIRLNTLETLNHLGFGHYGGGLSIVETLAVLYGDIMDINPEKFK
ESDRDYMVLSKGHAGPALYSTLYLKGFFDKTFLHSLNTNGTKLPSHPDRNLTPGIDATTG
SLGQGISIATGIAYAQKIENSSYYTYTIVGDGELNEGQCWEAIQFAAHHHLHHLIVFVDD
NKKQLDGLTADICNPRDFVAKFEAFGFDAVRVKGDDIEAIDKAIKTFQDSNSVRPKCIIL
DSIKGQGVKELEELASNHHLRPGLQQKTMLERAVISLRESLEVVE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaccagaagaaagatattcatctctaagacgatttgcaacggagattcgttta
aatacactagaaacgctaaaccatttaggattcggtcactatgggggtggtttatcaatt
gttgagactttggctgttctgtacggtgatattatggatataaatcctgaaaaattcaaa
gaaagtgatcgggattatatggtcttatcaaaaggacatgctggtccagccttgtatagt
acactctatctaaaaggtttttttgataaaacattccttcattcgctcaatacaaacggt
accaaactaccttcgcatcctgaccgcaatttaactcctggtatagatgcgacgacaggc
tcgttaggtcaaggcattagtattgcaacgggaattgcttatgctcaaaagattgagaat
tcaagctattatacttatactattgtaggtgatggtgaattaaatgaaggacaatgttgg
gaggctatacaatttgctgcgcatcatcatctgcaccatttaattgtttttgtagatgat
aataaaaaacaattagatggtttgacagctgatatttgtaatcctagagactttgttgct
aaatttgaagcttttggatttgatgcagtacgtgtaaaaggagatgacattgaggcaatt
gacaaagctattaaaacttttcaagattcaaatagtgtcagaccaaaatgtattatttta
gatagtatcaagggacaaggtgtgaaagaattggaggagttagcttctaatcatcattta
cgaccaggtttacaacaaaaaacaatgttagagcgagcggtaataagcttgagagaaagt
ttggaggtagtagaatga

KEGG   Streptococcus agalactiae ILRI005: MSA_2670Help
Entry
MSA_2670          CDS       T02704                                 

Definition
(GenBank) Transketolase, C-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
sagi01230  Biosynthesis of amino acids
Module
sagi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_2670
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    MSA_2670
Enzymes [BR:sagi01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     MSA_2670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: CCW39160
LinkDB All DBs
Position
219884..220813
Genome map
AA seq 309 aa AA seqDB search
MRCSTKEMRLVYRDFLLQANQENKQITVLEADLSSSMSTNALASEFGKRYINLGIMEAEM
VGLAAGLAIKGYKPYLHTFGPFASRRVFDQVFLSLGYSQLSATIIGSDAGVSAEMNGGTH
MPFEELGLLRLIPKATIFEVSDDIQFEAILKQTLSIDGLKYIRTIRKAPTAVYEGCEDFS
KGFIQLRQGKDIALVASGIMVSRAIEAADYLKEMGIEASVIDLFKIKPLPEELKPLLIDQ
SIVTIENHNRIGGIGSALCEWLSMEKDTTVSRMGIDERFGQVGQMEYLLEEYGLAVKDIV
EHCKSIYKS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagatgttcaaccaaagaaatgaggcttgtctatcgtgatttcctccttcaagctaat
caagaaaataaacaaattaccgttttagaagccgatttgtcgagttcaatgtcaacaaat
gcactggcatcagaatttggaaaacgttatattaatctaggtattatggaggctgagatg
gtaggccttgcagcagggctcgccattaaaggttacaagccataccttcatacttttggt
cctttcgcgtcaaggcgtgtctttgatcaagtattcttatcgttaggttactcacaatta
tcagctacgattattggctcagatgcaggagttagcgcagaaatgaatggcggaactcat
atgccttttgaagagttaggtctactaaggttaattccaaaggcgactatttttgaggtt
agtgatgatattcagtttgaagcaattttaaaacaaacattaagcattgatggcctaaaa
tacattagaactattcgtaaggcccccactgcagtttatgagggatgcgaagatttttca
aaaggttttatacaattacgccagggaaaagatattgctcttgtagcaagtggtattatg
gtttctagagcgatagaagcagccgactacctcaaagaaatggggattgaggcctcagtt
atcgacctttttaaaattaagccccttccagaagaattgaaaccattactgatagatcaa
tccattgtaactattgagaatcataaccgtattggcggtatcggaagtgcattatgcgaa
tggcttagtatggagaaagacactactgttagtcgtatgggtattgatgagcgatttggt
caggtaggtcagatggaatatttattagaggagtatggactcgctgttaaagatatagtc
gagcattgcaaatcaatttataaatcataa

KEGG   Streptococcus agalactiae ILRI005: MSA_3440Help
Entry
MSA_3440          CDS       T02704                                 

Definition
(GenBank) Transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
sagi01230  Biosynthesis of amino acids
Module
sagi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSA_3440
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    MSA_3440
Enzymes [BR:sagi01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     MSA_3440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: CCW39221
LinkDB All DBs
Position
277415..279400
Genome map
AA seq 661 aa AA seqDB search
MTFDTIDQLAVNTVRTLSIDAIQAANSGHPGLPMGAAPMAYVLWNKFLNVNPKTSRNWTN
RDRFVLSAGHGSALLYSLLHLAGYDLSIDDLKQFRQWGSKTPGHPEVNHTDGVEATTGPL
GQGIANAVGMAMAEAHLAAKFNKPGFDLVDHYTYTLHGDGCLMEGVSQEAASLAGHLKLG
KLVLLYDSNDISLDGPTSQSFTEDVKGRFESYGWQHILVKDGNDLEAIAAAIEAAKAETD
KPTIIEVKTIIGFGAEKQGTSSVHGAPLGAEGITFAKKAYGWEYPDFTVPAEVAARFASD
LQARGAKAEEAWNDLFAKYEVEYPELAAEYKEAFAGQAETVELKAHDLGSSVASRVSSQQ
AIQQLSTQLPNLWGGSADLSASNNTMVAAETDFQASNYAGRNIWFGVREFAMAAAMNGIA
LHGGTRVYGGTFFVFSNYLLPAVRMAALQNLPTVYVMTHDSIAVGEDGPTHEPIEQLASV
RSMPNLNVIRPADGNETNAAWQRAVSETDRPTMLVLTRQNLPVLEGTSELAQEGVNKGAY
ILSEAKGELDGIIIATGSEVKLALDTQDKLESEGIHVRVVSMPAQNIFDEQEASYQEQVL
PSAVTKRLAIEAGSSFGWGKYVGLNGLTLTIDTWGASAPGNRIFEEYGFTVENAVSLYKE
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgacatttgacaccattgatcaattagcggttaatacagtccgcacgctttctattgat
gctatccaagcagcaaattctgggcacccaggtcttcctatgggagctgcgcctatggct
tatgtgctttggaataaattcttaaatgtaaacccaaaaacaagtcgcaattggacaaac
cgtgaccgttttgtgctttcagctgggcatggttcagctcttctttatagcctacttcat
ttagctggctatgatttatcaattgatgatttaaaacaatttcgccaatggggatcaaaa
acacctggacatccagaagttaaccatactgatggtgtagaagcaacaactggaccttta
gggcaaggtattgctaatgctgttggtatggcaatggctgaagctcatttggctgctaaa
tttaataaaccaggctttgatttagttgatcattacacttatacacttcatggtgatggt
tgtttgatggagggtgttagccaagaagctgccagtcttgctggacacttaaaacttggt
aaattggtccttctttatgattcaaatgatatctcacttgatggtccaacatctcaatca
tttacagaagatgttaaaggacgttttgaatcatatggttggcaacatatcttagttaaa
gatggtaatgatttagaagcgattgctgcagcaattgaagctgctaaagctgaaactgat
aaaccaaccattattgaagttaaaactattattggatttggcgcagagaaacagggaaca
tcttcagttcatggagcgccacttggtgcagaaggtattacttttgccaagaaggcttat
ggatgggaatatccagactttactgttcctgctgaagttgcagctcgatttgcctcagat
cttcaagcgcgtggtgcgaaggcagaagaggcatggaatgatctttttgctaaatatgaa
gttgagtatccagaattagcagctgaatacaaagaagcttttgctggccaagctgagaca
gttgaattgaaagctcatgacctaggttcatcagtggctagtcgtgtttcaagccaacaa
gctattcaacaattatcgactcaattaccgaacctctggggagggtcagcagacctctca
gcttctaataacacaatggtagcagcagaaacagatttccaagcaagtaactacgctggg
cgtaacatttggtttggtgtacgtgaatttgcaatggctgctgcaatgaatggaattgcg
cttcacggtgggactcgtgtttatgggggtacgttctttgtcttctcaaactacttgtta
ccagcagtacgtatggctgcacttcaaaacttgccaactgtctatgttatgacacatgat
tctattgctgttggagaagatgggccaactcatgagccaatagaacaattagcatcagtg
cgctcaatgcctaatttgaacgttatccgtcccgcagacggtaatgaaacaaacgctgca
tggcaacgagctgtatcagagacagatcgaccaacgatgcttgttttaacacgtcaaaac
ttaccagttcttgaaggaacatcagaattagcccaagaaggggttaataaaggtgcttat
attttatcagaagctaaaggtgaacttgatggtatcatcattgcaacaggttcagaagtt
aaattagctttagatactcaagacaaacttgagtcagagggcatccatgttcgcgtcgta
tctatgccagcacaaaacatttttgatgaacaagaggcttcatatcaagagcaagtgctt
ccatcagctgttacaaaacgtcttgctattgaggcaggatcaagcttcggttggggtaaa
tatgttggtttaaatgggctaacacttactattgatacttggggagcatcagcaccaggt
aacagaattttcgaagagtatggctttacagttgagaatgctgtatcgctatataaagaa
ctttaa

DBGET integrated database retrieval system