KEGG   Streptococcus agalactiae ILRI005: MSA_4740Help
Entry
MSA_4740          CDS       T02704                                 

Definition
(GenBank) Glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00010  Glycolysis / Gluconeogenesis
sagi00030  Pentose phosphate pathway
sagi00500  Starch and sucrose metabolism
sagi00520  Amino sugar and nucleotide sugar metabolism
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01130  Biosynthesis of antibiotics
sagi01200  Carbon metabolism
Module
sagi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSA_4740
   00030 Pentose phosphate pathway
    MSA_4740
   00500 Starch and sucrose metabolism
    MSA_4740
   00520 Amino sugar and nucleotide sugar metabolism
    MSA_4740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagi04147]
    MSA_4740
Enzymes [BR:sagi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     MSA_4740
Exosome [BR:sagi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MSA_4740
  Exosomal proteins of other body fluids (saliva and urine)
   MSA_4740
  Exosomal proteins of colorectal cancer cells
   MSA_4740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: CCW39345
LinkDB All DBs
Position
402904..404253
Genome map
AA seq 449 aa AA seqDB search
MTHITFDYSKVLGQFVGEHELDYLQPQVSAADAFLRQGTGPGSDFLGWMDLPENYDKEEF
SRIQKAAEKIKSDSEVLVVIGIGGSYLGAKAAIDFLNNHFANLQTAEERKAPQILYAGNS
ISSTYLADLVEYVQDKEFSVNVISKSGTTTEPAIAFRVFKELLVKKYGQEEANKRIYATT
DKVKGAVKVEADANNWETFVVPDNVGGRFSVLTAVGLLPIAASGADITALMEGANAARKD
LSSDKISENIAYQYAAVRNVLYRKGYITEILANYEPSLQYFGEWWKQLAGESEGKDQKGI
YPTSANFSTDLHSLGQFIQEGYRNLFETVVRVEKSRKNVTIPELTEDLDGLGYLQGKDVD
FVNKKATDGVLLAHTDGGVPNMFVTLPTQDAYTLGYTIYFFELAIGLSGYLNSVNPFDQP
GVEAYKRNMFALLGKPGFEELSAELNARL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacacatattacatttgactattcaaaagtcttgggtcaatttgtaggcgaacacgag
ttagactacctacaaccacaagtaagtgcagcagatgctttccttcgtcaagggactggt
cctggatcagattttctcggatggatggacctcccagaaaactatgacaaagaagaattt
tctcgcattcaaaaagccgctgaaaagattaaatcagatagcgaagtactcgtggttatt
ggtattggtggttcgtaccttggcgcaaaagcagcaattgactttttgaataatcatttt
gctaatttgcaaaccgcagaagaacgtaaagcgcctcagattctttatgctggaaattct
atttcatctacttaccttgccgatttagttgaatacgtccaagataaagaattctcagta
aatgtcatttcaaaatcaggtacaacaactgaaccagcgattgctttccgtgtatttaaa
gaacttctagttaaaaagtacggtcaagaagaagctaataaacgtatctacgctacaact
gataaagttaaaggtgccgtaaaagttgaagcagatgctaacaattgggaaacatttgta
gttcctgataatgttggtggtcgtttctcagtactgacagccgtaggtcttcttccaatt
gctgcttcaggagcagatattactgctcttatggaaggcgcaaatgctgctcgtaaagat
ttatcttcagataaaatctctgaaaacattgcttatcagtacgctgccgttcgtaatgtt
ctttatcgcaaaggttatatcacagagattttagctaactacgaaccatcattacaatac
tttggtgaatggtggaaacaattagcaggtgaatcagaaggtaaagatcaaaaaggtatc
taccctacatcagcaaacttctcaactgatcttcactcacttggtcaatttattcaagaa
ggttaccgtaacctctttgagacagttgttcgcgttgagaaatctcgtaaaaatgtgact
attcctgaattaaccgaagatttagatggtcttggttatcttcaaggaaaagatgtagat
tttgttaataaaaaagcaacagatggtgtgcttcttgctcatacagatggtggggttcca
aatatgtttgtaacgcttcctacacaagacgcttacactcttggttacactatttacttc
tttgagttagcaattggcctttcaggttatcttaactcagtaaatccatttgatcaacca
ggggtagaagcatataaacgtaatatgtttgctcttctaggtaaacctggattcgaagag
cttagcgctgaattgaatgcacgtctttaa

DBGET integrated database retrieval system