KEGG   Streptococcus agalactiae ILRI005: MSA_6190Help
Entry
MSA_6190          CDS       T02704                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase, Bacillus type
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00010  Glycolysis / Gluconeogenesis
sagi00030  Pentose phosphate pathway
sagi00051  Fructose and mannose metabolism
sagi00680  Methane metabolism
sagi01100  Metabolic pathways
sagi01110  Biosynthesis of secondary metabolites
sagi01120  Microbial metabolism in diverse environments
sagi01130  Biosynthesis of antibiotics
sagi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSA_6190
   00030 Pentose phosphate pathway
    MSA_6190
   00051 Fructose and mannose metabolism
    MSA_6190
  09102 Energy metabolism
   00680 Methane metabolism
    MSA_6190
Enzymes [BR:sagi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MSA_6190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: CCW39481
LinkDB All DBs
Position
543626..545557
Genome map
AA seq 643 aa AA seqDB search
MSNFYKLLKEKFPRKEDIVTEMINLEAICQLPKGTEYFISDLHGEYDAVDYLLRTGAGSI
RAKLLDCFDWQKIVAVDLDDFCILLYYPKEKLAFDKMNLSASAYKTKLWEMIPLQIQVLK
YFSSKYTKSKVRKQLPGKFAYIIEELLAEIDRNPEKKSYFDTIIEKLFELDQVEDLIIVL
SQTIQVLIIDHLHVVGDIYDRGRYPDRILNRLMAFPNLDIQWGNHDVTWMGAASGSYLCM
VNVIRIAARYNNITLIEDRYGINLRRLVDYSRRYYEPLPSFAPILDGEEMTHPDELDLLN
MIQQATAILQFKLEAQLIDRRPEFQMHNRQLINQVNYKDLSISIKGVVHQLKDFNSRCID
SKNPSRLTSEEEELLQQLMIAFQTSESLKKHIDFLFEKGSMYLTYNDNLLFHGCIPMHSN
GDFKSFKIAGKTYGGRDLLDLFESQIRLAYARPEKHDDLATDIIWYLWCGENSSLFGKDA
MTTFERYYVSDKVTHQERKNPYFKLRDKDDICTALLQEFDLPKFGHIVNGHTPVKEKNGE
QPIKANGKMLVIDGGFAKGYQKNTGLAGYTLIYNSYGIQLISHLPFTSIEEVLSGTNYII
DTKRLVEEAKDRILVKDTTIGQKLTKEIKDLDHLYHHFQEYDD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatttttataagctcttgaaagaaaaatttcctcgaaaagaagatattgtaaca
gaaatgatcaatttagaagctatttgtcaattacccaaagggacggaatattttattagt
gatttacacggggaatatgatgctgttgattatctcttacggacaggtgcaggctctatt
agagctaaattattagactgctttgattggcagaaaatagttgctgttgatttagatgat
ttttgtatactgctttattacccaaaggaaaaattagccttcgataaaatgaacttgtca
gcaagtgcttataaaacgaagttatgggaaatgattccgttacaaatacaagttttaaaa
tatttttctagtaaatatacaaaatctaaagtacgtaagcaattgccaggtaagtttgct
tacattatcgaagaacttttagctgagattgaccgtaacccagagaagaaaagctatttt
gatactattattgaaaaattatttgaattagaccaagtagaagatttaattatagtatta
tctcaaacaattcaagttttaatcattgaccatttacatgttgtaggggatatttacgat
cgtggtagatatcctgatcgtatcttgaataggttaatggcttttccaaatttggatatc
caatgggggaaccatgatgtcacttggatgggagcagcatctggttcctacctttgtatg
gtaaatgttatccgtattgctgcacgttataataatattactttaattgaagaccgatat
ggtatcaatttgcgtcgcttggttgattactcacgccgttactatgaacctctaccttct
ttcgctcctatattagatggagaggaaatgactcatccagatgaactagacttgttaaat
atgatacaacaagcaacagcaattttacagtttaaattggaagcccaattgattgacagg
cgtccagaatttcaaatgcataatcggcaacttattaaccaggtaaattataaagattta
agtatatctataaagggagttgtgcatcaacttaaagattttaatagtagatgcattgat
tcgaaaaatcccagtcgattaacaagtgaggaagaagagcttttacaacaattgatgata
gccttccagacttctgaaagtttaaagaaacatattgatttcttatttgagaaaggaagt
atgtatttaacctataatgataatcttttattccatggttgcataccaatgcatagtaat
ggtgattttaaaagctttaaaattgcaggaaaaacttatggtggtagggatttactggat
ttatttgaaagtcaaatacgtctagcatatgctagaccagagaaacatgatgatttggcg
acagatatcatttggtatctttggtgtggtgaaaattcttctctttttggtaaggatgcc
atgactacttttgagcgctattatgtttccgacaaagtaactcatcaagaaagaaaaaat
ccctactttaaactgagagataaagatgatatttgcactgctcttttacaagagtttgat
ttgcctaagtttggacatattgtcaatggtcatacgccagtcaaagaaaaaaatggtgag
caaccgataaaagcaaatggtaagatgttagtaattgatggtggctttgccaaaggttat
cagaaaaatacaggtttagctggctacactttgatttataatagctatgggatacaatta
atttcacaccttccttttacatccattgaggaagttttaagtggaaccaactatatcatt
gatacgaagcgattagtagaagaagccaaggataggattcttgtaaaagatacaactatt
ggacaaaagttaaccaaagagattaaagacttagatcacctttatcatcattttcaggaa
tatgatgactag

DBGET integrated database retrieval system