KEGG   Streptococcus agalactiae ILRI005: MSA_9670Help
Entry
MSA_9670          CDS       T02704                                 

Definition
(GenBank) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (NADP)
  KO
K00131  glyceraldehyde-3-phosphate dehydrogenase (NADP+) [EC:1.2.1.9]
Organism
sagi  Streptococcus agalactiae ILRI005
Pathway
sagi00010  Glycolysis / Gluconeogenesis
sagi00030  Pentose phosphate pathway
sagi01100  Metabolic pathways
sagi01120  Microbial metabolism in diverse environments
sagi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sagi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSA_9670
   00030 Pentose phosphate pathway
    MSA_9670
Enzymes [BR:sagi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.9  glyceraldehyde-3-phosphate dehydrogenase (NADP+)
     MSA_9670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LuxC Succ_DH_flav_C SNAD3
Motif
Other DBs
NCBI-ProteinID: CCW39828
LinkDB All DBs
Position
847890..849317
Genome map
AA seq 475 aa AA seqDB search
MTKEYRNYVNGEWKSSVNQIEILSPIDDSSLGFVPAMTREEVDHAMKAGREALPAWAALT
VYERAQYLHKAADIIERDKEEIATVLAKEISKAYNASLTEVVRTADLIRYAAEEGIRLST
SADEGGKMDASTGHKLAVIRRQPVGIVLAIAPYNYPVNLSGSKIAPALIGGNVVMFKPPT
QGSVSGLVLAKAFAEAGLPAGVFNTITGRGSEIGDYIVEHEEVNFINFTGSTPVGKRIGK
LAGMRPIMLELGGKDAGIVLADADLDNAAKQIVAGAYDYSGQRCTAIKRVLVVEEVADEL
AEKISENVAKLSVGDPFDNATVTPVIDDNSADFIESLVVDARQKGAKELNEFKRDGRLLT
PGLFDHVTLDMKLAWEEPFGPILPIIRVKDAEEAVAIANKSDFGLQSSVFTRDFQKAFDI
ANKLEVGTVHINNKTGRGPDNFPFLGLKGSGAGVQGIRYSIEAMTNVKSIVFDMK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaaagaatatcgaaattatgtcaatggcgaatggaaatcatctgttaatcagatt
gagattttgtcaccaattgatgattcttcattgggattcgtgccagcgatgactcgagaa
gaagttgatcatgccatgaaagcgggtcgtgaagctttaccagcctgggctgctttgaca
gtatatgaacgtgcacaataccttcataaagccgcagacattattgaacgtgataaagaa
gaaattgctactgttttagcaaaagaaatttctaaagcttacaatgcttcattaactgag
gttgtaaggacagctgatcttattcgttatgcagcagaagaaggaattcgtttatcaact
tcagctgacgaaggtggaaaaatggatgcttcaacaggtcataagttggctgttattcgt
cgtcaaccagtaggtatcgttttagcaatcgcaccttataattaccctgttaacctctca
ggatcaaaaattgcgccagctctaattggtggaaacgttgtgatgtttaaaccaccaaca
caaggttcagtctcaggacttgttttagcaaaagcttttgcagaagcaggtcttccagca
ggtgtctttaatactattacaggacgcggttctgagattggagattacattgttgagcat
gaagaagttaattttattaactttacaggatcaacgccagttggaaaacgtattggtaag
ttagcaggaatgcgtccaattatgcttgagttgggtggtaaggatgcaggtatcgtctta
gctgatgctgaccttgacaacgctgctaaacaaatcgttgcaggtgcttatgattactct
ggacaacgctgtacggcaattaagcgtgtgcttgtcgttgaagaagttgcagatgaattg
gcagaaaaaatatctgaaaatgtagcaaaattatcagtaggtgatccatttgataatgca
acggtgacaccggttattgatgataattcagctgactttattgaaagcttagtagtagat
gcacgtcaaaaaggtgcgaaagaattgaatgaatttaaacgtgatggccgtctattaact
ccaggattgtttgatcatgttactttagatatgaaactagcttgggaagagccttttgga
ccaattctcccaattattcgtgtcaaggatgcagaagaagctgttgctattgccaacaaa
tctgattttggattacaatcatcagtctttacacgtgatttccaaaaagcatttgatata
gcaaataaacttgaagttggtacagttcacattaacaataagactggacgtggtcctgat
aatttcccattcttaggactcaaaggatctggtgcaggtgttcaaggtatcagatattca
attgaagcaatgacaaatgtaaaatcaatagtttttgatatgaaatag

DBGET integrated database retrieval system