KEGG   Streptomyces alboflavus: SMD44_04844Help
Entry
SMD44_04844       CDS       T05221                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
salf  Streptomyces alboflavus
Pathway
salf00250  Alanine, aspartate and glutamate metabolism
salf00410  beta-Alanine metabolism
salf00430  Taurine and hypotaurine metabolism
salf00650  Butanoate metabolism
salf01100  Metabolic pathways
salf01110  Biosynthesis of secondary metabolites
salf01120  Microbial metabolism in diverse environments
salf02024  Quorum sensing
Module
salf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:salf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMD44_04844
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMD44_04844
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMD44_04844
   00430 Taurine and hypotaurine metabolism
    SMD44_04844
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SMD44_04844
Enzymes [BR:salf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SMD44_04844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ARX85383
UniProt: A0A1Z1WG08
LinkDB All DBs
Position
complement(5284521..5285894)
Genome map
AA seq 457 aa AA seqDB search
MPLHHGPDRPDDRALSVNPFYGEANPVGGMTEAPPKHRLPDGPLPPMTAYQLVHDELMLD
GNSRLNLATFVTTWMEPQAGVLMAECRDKNMIDKDEYPRTAELERRCVAMLADLWNAPDP
AAAVGCSTTGSSEACMLAGMALKRRWARRNADRYPSREARPNLVMGVNVQVCWEKFCDFW
EVEARQVPMEGDRFHLSAEAAAALCDENTIGVVAVLGSTFDGSYEPVADVCAALDALQER
TGLDVPVHVDGASGAMVAPFLDEDLVWDFRLPRVSSINTSGHKYGLVYPGVGWALWRTPA
ELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGFRAVQQASRDVARGL
ATRIEALGDFRLLTRGTSCPCSPSPRRRAWAPMTCSMWPGGCGSGGGWCPPIRFRLTGRI
WRCCGSSAGTGSRPTSRSSSWRTWGGSCPSCGVSRIR
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcccctccaccacggccccgaccggcccgacgaccgcgccctctcggtgaacccgttc
tacggcgaggcgaaccccgtcggcggcatgaccgaggccccgcccaagcaccggctcccc
gacgggccgctgccgcccatgaccgcgtaccagctcgtccacgacgaactcatgctggac
gggaactcccgcctcaacctcgccaccttcgtcaccacctggatggagccgcaggccgga
gtcctgatggcggagtgccgggacaagaacatgatcgacaaggacgagtacccgcggacg
gcggagctggagcggcgctgcgtcgccatgctcgccgacctctggaacgcccccgacccg
gccgccgccgtcggctgctcgaccaccgggtccagcgaggcctgcatgctcgccgggatg
gccctcaaacgccgctgggcgcgccgcaacgccgaccgctacccctcccgggaggcccgg
cccaatctcgtcatgggcgtcaacgtgcaggtctgctgggagaagttctgcgacttctgg
gaggtcgaggcgcggcaggtgcccatggagggcgacaggttccacctctccgccgaggcc
gccgccgcgctctgcgacgagaacaccatcggcgtcgtcgccgtcctcggctccaccttc
gacggctcctacgagcccgtggccgacgtgtgcgccgcgctcgacgccctccaggagcgg
accgggctcgacgttcccgtccacgtcgacggggcctccggggcgatggtcgcgcccttc
ctcgacgaggacctcgtctgggacttccggctgccccgcgtctcgtcgatcaacacctcc
gggcacaagtacgggctcgtctacccgggcgtcgggtgggcgctgtggcgtacgcccgcc
gagctgcccgaggaactcgtcttccgcgtcaactatctcggcggggacatgcccacgttc
gcgctgaacttctcccggcccggggctcaggtcgtcgcgcagtactacacgttcctgcgg
ctcgggcgggagggcttccgggccgtccagcaggcgtcccgggacgtcgcccgggggctt
gccacgcggatcgaggccctcggggacttccggctgctcactcgggggacgagttgcccg
tgttcgccttcaccacggaggcgggcgtgggcgcctatgacgtgttcgatgtggcccggc
ggttgcgggagcgggggtggttggtgcccgcctatacgtttccggctcaccgggaggatc
tggcggtgctgcgggtcgtctgccggaacgggttctcgtccgacctcgcgcagctcttcg
tggaggacctggggcggctcctgcccgagctgcggcgtcagccgcatccgctga

DBGET integrated database retrieval system