KEGG   Shewanella algae: BS332_17285Help
Entry
BS332_17285       CDS       T05622                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
salg  Shewanella algae
Pathway
salg00550  Peptidoglycan biosynthesis
salg01100  Metabolic pathways
salg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:salg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BS332_17285
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BS332_17285
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BS332_17285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:salg01011]
    BS332_17285
Enzymes [BR:salg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BS332_17285
Peptidoglycan biosynthesis and degradation proteins [BR:salg01011]
 Precursor biosynthesis
  Amino acid ligase
   BS332_17285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AXQ15747
LinkDB All DBs
Position
complement(3813896..3814906)
Genome map
AA seq 336 aa AA seqDB search
MSKTHILLLCGGGAAEHSISLMSADYIESCLANIPDMEVLRLELDAAGHYHTKQGQVCEL
TNRREVRFDEAEPSWPVDYVIPCIHGYPGETGDIQSYFNLINLPYFGCGSEPSSNCFNKV
TAKMWFSALGIPNTPYLFLSEAGEAANTRCREALNEWGSLFIKAASQGSSVGCYRVDNGD
DIPSVLEQAFSYSPYVVVEKAIKARELEVAVYEYQGEVIATVPGEIICANNTFYSFDEKY
DAKSKAVTKVEAELSQAQIDTIRDYAIRAFKGMKLSHLSRIDFFLTDEGEILLNEINTFP
GMTPISMFPKMLSNNGHDVSEWLVSNIRRHLSEPLK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacccatatcttgttactctgtggcggcggggccgccgagcacagtatctct
ttgatgtcggctgactatatcgaaagctgcctggcaaatattcccgacatggaagtgctc
aggttggagctggacgccgccggccactaccacaccaagcagggccaggtttgcgagctg
accaatcgccgtgaagtgcgcttcgatgaggccgagcccagctggccggtggactatgtg
atcccctgtattcacggctatccgggtgagaccggcgatattcagtcctatttcaatctg
atcaacctgccctatttcggttgcggctccgaacccagcagcaactgcttcaacaaggtc
acggccaagatgtggttcagtgcgctcggcatccccaataccccttatctgtttctcagt
gaagccggtgaagcggccaacacccgctgccgtgaggccttgaatgaatggggctcactg
tttatcaaggcggcatcccaagggtcatccgtcggctgttaccgggtggacaacggcgat
gatatcccctcggtgctggagcaagccttcagttactccccctacgtggtggtggaaaag
gccatcaaagccagggagctggaagtggccgtatatgaataccagggtgaagtgatagcc
acagtgccgggtgagatcatctgcgccaacaacaccttctacagcttcgatgagaagtat
gatgccaagagcaaggcggtgaccaaggtcgaggccgaattgagccaagcgcaaatcgat
accatacgcgattatgccattcgcgcctttaagggcatgaagctgtcccacctgtcgcgt
atcgacttcttccttaccgatgaaggcgagatactgctcaatgagatcaataccttcccg
ggcatgacgcccatctccatgttccccaagatgctcagcaacaatggccatgatgtcagc
gagtggttggtgagtaacataagacgccatctgagcgaaccgctcaagtaa

DBGET integrated database retrieval system