KEGG   Streptomyces albireticuli: SMD11_3910Help
Entry
SMD11_3910        CDS       T05230                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
salj  Streptomyces albireticuli
Pathway
salj00564  Glycerophospholipid metabolism
salj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMD11_3910 (glpA)
Enzymes [BR:salj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SMD11_3910 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N DUF2937
Motif
Other DBs
NCBI-ProteinID: ARZ69525
UniProt: A0A1Z2L5F3
LinkDB All DBs
Position
4441700..4443406
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERGAALARMAERELDILVVGAGVVGAGTALDAATRGLTTGLVEARDWAAGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHRAWERVY
AGSGVALYDAMSVSSGHGRGLPTHRHLSRKRALRVAPCLRKDALIGALQYYDAQMDDARY
VTTLVRTAAAYGADAANRARVVGFLREGERVVGARVLDVEQGGEFEIRARQIVNATGVWT
DDTQKLIAERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLEHVNEVLAVPLTRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLAQRVADCVTEDVPLVGAEGYKAL
WNGRAQIAQRTGLHVARVEHLLNRYGSMVDELLALVTDDPSLGEPLTGAEDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSAREAAGLMAPVLGWDEAQIEKEVQHYEKRV
EAERESQRQPDDLTADAARLGAPDIQPL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaggacggcgacactcggtccggcggagcgcggtgcggcgctcgcccggatggcggag
cgggaactggacatcctggtggtcggcgccggcgtcgtcggcgcgggtaccgcgctcgac
gcggccacccgggggctcacgaccgggctcgtcgaggcgcgggactgggcggcgggcacc
tccagccggtccagcaagctgatccacggcgggctgcgctatctggagatgctcgacttc
gcgctcgtacgcgaggcgctcaaggagcgcgggctgctgctggagcggctggcaccgcac
ctggtgaagcccgtgcccttcctctaccccctccagcaccgcgcctgggagcgcgtctac
gccggctcgggcgtcgccctctacgacgccatgtcggtctcctccgggcacgggcgcggg
ctgcccacccaccggcacctctcccgcaagcgcgcgctgcgggtcgcgccctgcctgcgc
aaggacgccctgatcggcgcgctccagtactacgacgcccagatggacgacgcccgctat
gtgacgaccctcgtgcgcaccgccgccgcctacggcgcggacgccgcgaaccgggcgcgc
gtggtcggcttcctccgggagggtgaacgggtggtcggcgcccgcgtcctggacgtcgag
cagggcggcgagttcgagatccgcgcccggcagatcgtcaacgccacgggagtgtggacc
gacgacacccagaagctcatcgccgagcgcggccagttccacgtacgggcctccaagggc
atccacctggtcgtgccgaaggaccgcatccactccaccaccgggctgatcctgcgcacg
gagaagagcgtgctcttcgtgatcccctggggcaggcactggatcatcggcaccacggac
accgactgggacctggacaaggcgcacccggccgcctccagcgcggacatcgactatctg
ctggagcacgtcaacgaggtgctcgcggtgcccctcacccgcgacgacgtccagggggtg
tacgcggggctgcgccccctcctggccggggagtcggacgcgacgagcaagctctcgcgc
gagcacaccgtggcgcaccccgtgcccggcctggtggtcgtggcgggcggcaagtacacg
acgtaccgggtgatggcgaaggacgcggtggacgaggcggtgcacgggctcgcgcagcgg
gtcgcggactgcgtcacggaggacgtgccgctggtgggcgccgaggggtacaaggcgctg
tggaacgggcgcgcccagatcgcccagcgcacgggcctgcacgtggcccgcgtcgagcac
ctgctcaaccgctacggctcgatggtcgacgagctgctggccctcgtcaccgacgacccc
tccctgggcgagccgctcacgggcgccgaggactatctgcgggcggaggtcgtctacgcc
gcctcgcacgagggcgcgcgtcacctggacgacgtcctcacccgccggacccggatctcg
atcgagaccttcgaccggggcacgcgcagcgcgcgggaggccgccgggctgatggcgccc
gtcctgggctgggacgaggcgcagatcgagaaggaggttcagcactacgagaagcgggtg
gaggcggaacgggagtcgcagcgtcagccggacgacctgacggcggacgcggcccggctg
ggtgcgccggacatccagccgctgtag

DBGET integrated database retrieval system