KEGG   Salvelinus alpinus (Arctic char): 111972593
Entry
111972593         CDS       T05762                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00230  Purine metabolism
salp01100  Metabolic pathways
salp04020  Calcium signaling pathway
salp04114  Oocyte meiosis
salp04261  Adrenergic signaling in cardiomyocytes
salp04270  Vascular smooth muscle contraction
salp04371  Apelin signaling pathway
salp04540  Gap junction
salp04912  GnRH signaling pathway
salp04914  Progesterone-mediated oocyte maturation
salp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111972593
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111972593
   04020 Calcium signaling pathway
    111972593
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111972593
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111972593
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111972593
   04914 Progesterone-mediated oocyte maturation
    111972593
   04916 Melanogenesis
    111972593
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111972593
   04270 Vascular smooth muscle contraction
    111972593
Enzymes [BR:salp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111972593
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Calmodulin_bind fn3_4
Other DBs
NCBI-GeneID: 111972593
NCBI-ProteinID: XP_023855377
LinkDB
AA seq 1106 aa
MSLNRVYTDTEQSAEDSGECSATVSSDNGHGAGRTHEVTVRNTGCCVCLPRIMRLTFAPE
SLERLYQVYFRRQRQETLLVLVVFAALFNCYVIVMCAVVYTTDKRAMIVVAAVGLAADIV
LYTLCRLRKLPAAPVVRCAIPYILWLMIAVHVLCYLGLNYQLSPQASDTAGWQAFFSFSC
FLTLPLTLVPLLLLTALSCGIHTLVLGVTIAQRHQDSLQGTILLRQLLANWVLYLCAVTV
GVISYYMADRKYRTAFLEARQSLEVKLTLEEQSTQQEELLLSILPKHIAEEMLEGMKKQA
NQNEVQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAQHH
QLRIKILGDCYYCICGLPDYRDDHAACSIMMGLAMVEAISYVREKTKTEVDMRVGVHTGT
VLGGVLGQRRWQFDVWSTDVTVANKMESGGIPGRVHISQSTMECLHGEFDLEPGNGGERC
EYLLEKGIDTYLVLFSKETTQVNGLNRVNRNSPQLINTTETNGSVSSVRGTPRERKQEAK
TQVTSPQRQIKKKVDARESEQELNRLLHLELLARENEETAKERRTNPVSLQFVDGELEGR
YSAEKERQSGVAFCCSCLVLFFTAGMEVLIDPMLVVNYVTLAIGEGLLLILTICSMAAVF
PRMFSKRLVSFSMWIDRTRWARNTWAMAAIFVLTMAEIADMLSCVQPPFLFLNTSAGLSR
ESLGDGGCAENPKHYSYMAVLSLVATTMLVQVSHLVKLGLMLLVIVATGAVNIYSWRDIY
DTYDFIRFTSYRMSIVPSKYLMTVMIMIMMICFYYFARHVERQSRKLFLWKIEVHDQKER
VFEMRRWNEALVTNMLPEHVAKHFLGSKKRDEELYSQSYDEIGVMFASIPNFSDFYTEEG
INNGGIECLRILNEIISDFDSLLDRNEFRFITKIKTIGSTYMAASGVTPESNTNGYCNRP
IEEQSLLERWQHLADLADFALAMKVTLTKLNDQSFNNFMLRIGLNKGSVLAGVIGARKPH
YDIWGNTVNVASRMESTGVMGNIQVVEDCYDILKEYGFRFVRRGPIFVKGKGELLTFFMK
GKDKTSSNGTGPTTTTALPHQVVDHS
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgtctctaaaccgggtttacacggacacggagcagtctgcagaggattctggagaatgt
tcggccacagtctcgtcggacaacgggcacggggcaggtcgtacgcacgaggtgaccgtg
cgcaacaccggctgctgcgtgtgcctgccgcgcatcatgcgcctcacctttgcgcccgag
tccctcgagcggctctaccaggtctacttccgacggcagcgacaggagactcttctcgtg
ctggtggtgtttgcagcgcttttcaactgctatgtcattgtcatgtgcgcagtggtgtac
acgacagacaaacgtgcaatgatcgtggtcgcggcagttggacttgctgcggatattgta
ctctacacgctttgccgactgcgcaagctccccgcggcgcctgttgtgcgctgtgcgata
ccatacatactctggctgatgatagccgtgcacgtgctgtgctacctggggctgaactac
cagctttccccccaggccagtgacacagcgggctggcaggccttcttcagcttctcttgc
ttcctgacgctgcccctgaccctggtccctctcctgctgctcacagctctgtcctgtggg
atccataccctggtgctgggggtcaccatcgcccaaaggcaccaggacagcctgcaggga
accatactgctcagacagctcctggctaactgggtgttgtacctgtgtgcggtcactgtg
ggcgtgatatcatactacatggccgacaggaagtaccgaacggctttcctggaggcgcgc
cagtccctggaggtcaaactcaccctggaggagcagagcacccagcaggaggagttgttg
ctgtccatcctgcccaaacacatagcagaagagatgctggagggcatgaagaaacaggct
aaccagaacgaagtgcagcagttcaacaccatgtacatgtaccgtcatgagaacgtcagt
atcctatttgctgatatagtgggttttacccagctctcctcagcgtgtagtgcacaagag
ctggtcaagctgctcaacgaactgttcgcccgctttgacaagctagctgctcaacatcac
cagttgcgtatcaagatcctgggagactgttactactgtatctgtggcctgcctgattac
cgtgatgaccacgcagcctgttccatcatgatgggcctggccatggtggaggccatctcg
tatgtgcgtgagaagactaagacagaggttgacatgcgtgtgggggtgcacacaggcact
gtgctgggaggggtgctgggacagaggaggtggcagtttgatgtctggtccactgatgtc
actgtggccaacaagatggagtcaggagggatacctgggcgtgtccacatctcccagagc
accatggagtgtctgcatggagagtttgacctggagccggggaacggaggggagaggtgt
gagtacctgctggagaaaggcatagatacctacctggtgctgttctccaaggaaaccacc
caggtcaacggactcaacagggtaaatagaaactctccccagttgattaacaccacagag
accaatgggagcgtcagttcggtccggggcacgcccagagagcgcaaacaggaagcaaaa
acacaggtgacgagccctcagcgtcaaataaaaaagaaagtggatgccagggagagtgaa
caggagctgaacagactactgcacctggagctgctggcgagagagaacgaagagactgcg
aaggagcgtcggaccaaccctgtgtccctgcagtttgtggatggggagttggaggggcgt
tactctgcagagaaagaaagacagagtggtgtagctttctgctgcagctgcctggtcctc
tttttcactgcaggcatggaggtcctcatagacccaatgctggtagtgaactatgtgacc
ctggcgattggagaggggttgctgctcattctcactatctgctccatggctgccgtcttc
cctcgtatgttctcgaagaggctcgtgtcgttctcgatgtggatcgatcgaacccgttgg
gcacggaacacctgggccatggcagccatctttgttttaaccatggccgagattgccgat
atgctgagctgtgtccagcctcccttcctgttcctcaacaccagtgctggcctcagcagg
gagtctctaggtgatggaggttgcgcagaaaaccctaaacactacagctatatggcagtg
ctgtcgcttgtggcgaccaccatgctggtgcaggtgagccacctggtcaagctggggctc
atgctgctggtcattgtggcaacgggcgccgtcaacatctacagctggagggatatctac
gacacgtatgacttcatacgattcaccagctacaggatgtctatagtcccttccaagtac
ctgatgacagtgatgatcatgatcatgatgatctgcttctactactttgccagacatgtg
gagaggcagtcgcggaagcttttcctttggaagattgaggtgcatgaccagaaggagagg
gtgtttgagatgaggcgctggaatgaagcgctggtcaccaacatgctgcctgaacatgta
gccaaacacttcttgggttctaagaagagagacgaggagctgtacagccagtcatacgat
gagataggagtgatgtttgcctccatccccaacttctcagacttctacacagaggagggc
atcaacaatgggggcatagagtgtctgaggatcctcaatgagattatctctgactttgac
agtctgttggacaggaatgagttccgcttcatcactaagattaagactataggaagcacc
tacatggctgcgtctggagtcacacccgagagcaacaccaatggatactgcaaccgcccg
atagaggaacagtcattgttagaacgttggcagcacttagctgacctggcagactttgct
ctggccatgaaggtcactctcaccaaactcaacgaccaatccttcaacaacttcatgcta
cgcatcggtctgaataagggctcggttttggctggagtgattggagctcgtaaacctcat
tatgacatctggggcaacacagtcaatgtagccagcagaatggagtctacaggggtgatg
ggcaacatccaggtggtggaggactgttacgacatcctaaaggagtacggattccgcttc
gtcaggagaggccccatcttcgtcaaggggaagggggagctactaaccttcttcatgaaa
gggaaagacaaaactagtagcaacggcaccggtcccaccactactactgcccttcctcac
caagtagtggaccattcctga

DBGET integrated database retrieval system