KEGG   Streptomyces albulus NK660: DC74_6539Help
Entry
DC74_6539         CDS       T03082                                 

Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
salu  Streptomyces albulus NK660
Pathway
salu00511  Other glycan degradation
salu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:salu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DC74_6539
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    DC74_6539
Enzymes [BR:salu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     DC74_6539
Bacterial toxins [BR:salu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   DC74_6539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 BNR Laminin_G_2 Laminin_G_1 DUF4185 DUF3509
Motif
Other DBs
NCBI-ProteinID: AIA06974
UniProt: A0A059W650
LinkDB All DBs
Position
complement(7469086..7471023)
Genome map
AA seq 645 aa AA seqDB search
MTSDLRAHPLPRRRPRRRRAPSAVAALTVAALTALATAPARAATDAPSGGFAQQVLFKAA
HEKGYACFRIPAIVRTVRGTLLAFAEGRVHDCGDAGDIDLVLKRSTDGGRTWGPLEVVNH
GDGDTHGNPAPLVDRRTGRIVLAETYNKGRTDGLSCDVPCDRTPHLQYSDDDGATWSAPR
DLTRSIRPRRWNSWYATGPVHGIQLAHGRHAGRLVFGVNAESYAGNRITANHAALVHSDD
GGTTWKVGALDSWPIAPDGTFRQKPSEMTLLERSDGSLYVNGRDQDGTDLGNRTAAVSRD
GGDTFTTPFRAIPDLYAPMVQASALRLPRSTAAGGFGRTLLAAPADPDRRRTMTIRSSYD
EGRTWEGVDRGAQVTTDWSGYSDLVAISPTVTGLLYEGGAADARDEIRFARFTEQWLGPR
RGPDPTTPDLARGARPALVLGGARLTDGPFGRALSFDGTDDAVRLPYRDALPLGRADFTC
TLWFRYRATTGEQPLLWMGGVGSRAPQVAVEGDPAHGRITARLSAVDGARPPATAQVSGV
GAANDGKWHHVAVRRAGGRLLLTVDGTATTSTADVPGSVSRTTTFGVHLGQRPDGRAQFT
GALAEVRVYRRALTDAELSRVRVDDASVAGPLVLGLPLDRVAGGR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcagatctccgcgcgcaccccctcccccgccgcagaccccggcgccgccgcgcc
ccgtccgccgtcgccgcgctcaccgtcgccgcgctcaccgccctggcgaccgcgcccgcc
cgggccgccaccgacgccccgtcgggcggcttcgcgcagcaggtcctcttcaaggcggcc
cacgagaagggctacgcgtgcttccgtatacccgccatcgtgcgaaccgtccgcggcacc
ctgctcgccttcgccgagggccgggtgcacgactgcggggacgccggcgacatcgacctg
gtcctcaagcgctccaccgacggcggccggacctggggcccgctggaggtcgtcaaccac
ggcgacggcgacacccacggcaacccggcaccgctggtggaccgccgcaccggtcggatc
gtcctcgccgagacctacaacaagggccgcaccgacggcctcagttgcgacgtcccctgc
gaccgcaccccgcacctccagtacagcgacgacgacggcgccacctggtccgccccccgc
gacctgacccgcagcatccgcccgcgccggtggaactcctggtacgccaccgggccggtg
cacggcatccagctcgcccacggacggcacgcggggcggctggtcttcggcgtcaacgcc
gagagctacgcgggcaaccggatcaccgccaaccacgccgccctcgtccacagcgacgac
gggggcaccacctggaaggtcggcgcactggacagctggccgatcgcaccggacggcacc
ttccggcagaagccgtcggagatgaccctcctggagcgctccgacggctcgctctacgtc
aacggccgcgaccaggacggcaccgacctcggcaaccgcaccgccgcggtcagccgggac
ggcggcgacaccttcaccacccccttccgcgccatccccgacctctacgccccgatggtg
caggcgtcggcgctgcgcctgccccgctcgaccgccgccggcgggttcggccgcaccctg
ctcgccgcccccgccgaccccgaccgacgccggacgatgaccatccggtcctcctacgac
gagggccgcacctgggagggcgtggaccggggcgcccaggtcaccaccgactggtccggg
tactccgacctggtcgcgatctcccccaccgtcaccggcctgctctacgagggcggtgcc
gccgacgcccgggacgagatccgcttcgcccgcttcaccgagcagtggctcggaccgcgc
cgcggcccggacccgaccacgcccgacctggcccgcggcgcccggccggcgctggtgctc
ggcggggcccggctcaccgacggcccgttcggccgcgccctgtccttcgacggcaccgac
gacgcggtgcgcctgccctaccgcgatgcgctcccgctgggccgcgcggacttcacctgc
accctgtggttccgctaccgcgccaccaccggcgaacaaccgctgctgtggatgggcggc
gtgggcagccgggccccgcaggtcgccgtcgagggcgatccggcgcacggccggatcacc
gcgcggctgtcggcggtcgacggcgcccggccgccggccaccgctcaggtctccggcgtc
ggagccgccaacgacgggaagtggcaccacgtcgcggtgcgccgggcgggcggccggctg
ctgctgaccgtggacggcaccgcgaccaccagcaccgccgacgtccccgggtcggtcagc
cggaccacgacgttcggcgtgcacctgggccagcggccggacggccgggcccagttcacc
ggggcgctggcggaggtccgcgtctaccgacgggccctgaccgacgccgagctctcccgg
gtgcgcgtcgacgacgcgtcggtggccggcccgttggtgctcgggctgccgctggaccgg
gtggcgggcggccgctga

DBGET integrated database retrieval system