KEGG   Streptomyces ambofaciens: SAM23877_2349
Entry
SAM23877_2349     CDS       T04055                                 

Definition
(GenBank) conserved exported protein of unknown function
Organism
samb  Streptomyces ambofaciens
SSDB
Motif
Pfam: HtaA
Other DBs
NCBI-ProteinID: AKZ55398
UniProt: A0A0K2AQX8
LinkDB
Position
complement(2454167..2455600)
AA seq 477 aa
MPARLRALVTVVCAALLGFLLPAAAAHAESRTVQGGRLDWGIKSSFQSYVTGPVAKGSYS
LTGGAATVGGSAFRFHSAAGTYDGGTGALRAAFSGGVRFLGHPAGGGAHQLDLTISRPTV
SISGATGTLHVDVVSKAKGTGAVTTSRQVPFAALSLGGIDMRGGGSTVTLENLPATLTAE
GARSFAGYYTAGTALDPVSLSADVRVAAGQQEERREKQPSAPQAPSPKRQQSTGGAIEDG
AVDWGVRRTFREYVTGDIADGRWALTAGAQDGGALFRFPGGQGTYEDGDLTAAFEGAVRF
TGAHGLDLRLSGVRAGVEDGRGTLYADVDSPRLKAEKVPLVTFTAGTPRPADGQVRITEA
PAKLTARGAEAFGGMYRAGTAMDPVSLAVALTADAKLPALPDLGSGPTTSASPRPEQSPR
AAPGSSARPVASATDDGDFPALPVSLTAGALLLAAVLVSVAVRRRRTRPAASPSDRG
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgcccgcccgtcttcgcgccctggtcaccgtggtgtgcgcggccctcctcggcttcctg
ctccccgcggccgccgcacacgccgagagccggaccgtgcagggcggacggctcgactgg
ggcatcaagtcgtcgttccagagctatgtcaccgggccggtcgcgaagggcagttactcc
ctgaccggaggggcggccaccgtcggcgggagcgccttccgcttccactcggcggccggt
acctacgacggcggcacgggagccttgcgggccgccttctccggtggcgtccgcttcctc
ggccaccccgccggcggcggcgcccaccagctcgacctcaccatcagccgtcccaccgtg
agcatctccggcgccaccggcacgctccacgtggacgtcgtcagcaaggcgaagggcacc
ggggcggtcacgacgtcccgtcaggtgcccttcgccgccctctccctcggcggcatcgac
atgcggggtggcggcagcaccgtgaccctcgagaacctgcccgccaccctcaccgccgag
ggcgcccggtccttcgccgggtactacaccgccggcaccgcgctggacccggtgagcctg
tcggccgacgtacgggtggcggcgggacagcaggaggagcggcgggagaagcagccgtcc
gccccgcaggccccgtccccgaagcggcagcagtccaccggcggcgccatcgaggacggc
gccgtcgactggggcgtgcgacgcaccttccgcgagtacgtcaccggcgacatcgccgac
ggcaggtgggccctgaccgccggcgcccaggacggcggcgccctcttccgcttccccggc
ggccaggggacgtacgaggacggcgacctcaccgccgccttcgagggcgcggtgcgcttc
accggcgcgcacggcctcgacctccggctcagcggcgtacgggccggcgtcgaggacggc
aggggcacgctgtacgccgacgtggacagtccccgcctcaaggccgagaaggtgcccctg
gtcaccttcaccgccgggaccccgaggccggccgacggccaggtgcgcatcaccgaggcc
cccgcgaagctcaccgcgcgcggcgccgaggccttcggcggcatgtaccgggcgggcacc
gcgatggacccggtctccctggccgtcgccctcaccgccgacgcgaagctgcccgccctg
cccgacctgggcagcggccccacgacgagcgcgagcccgcggccggagcagtcgccacgg
gcggcgcccgggagctccgcacgacccgtcgcgagcgccacggacgacggcgacttcccc
gccctgcccgtctccctcaccgccggcgccctgctgctggccgcggtcctcgtgtccgtc
gccgtgcgcaggcgccgcacccggcccgccgcgtccccctcggaccggggctga

DBGET integrated database retrieval system