KEGG   Streptomyces ambofaciens: SAM23877_4149Help
Entry
SAM23877_4149     CDS       T04055                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00250  Alanine, aspartate and glutamate metabolism
samb00410  beta-Alanine metabolism
samb00430  Taurine and hypotaurine metabolism
samb00650  Butanoate metabolism
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
samb01120  Microbial metabolism in diverse environments
samb02024  Quorum sensing
Module
samb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAM23877_4149 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAM23877_4149 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAM23877_4149 (gadB)
   00430 Taurine and hypotaurine metabolism
    SAM23877_4149 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAM23877_4149 (gadB)
Enzymes [BR:samb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SAM23877_4149 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AKZ57194
UniProt: A0A0K2AW00
LinkDB All DBs
Position
complement(4403887..4405314)
Genome map
AA seq 475 aa AA seqDB search
MPLHQAPPTSHDDDRDRRRLAVNPFHGATNPLGGMTEAPPAHRLPDSPLPPETAYRLVHD
ELMLDGNARLNLATFVTTWMEPQAGVLMGECRDKNMIDKDEYPRTAELERRCVTMLADLW
HAPDPSAVVGCSTTGSSEACMLAGMALKRRWALRNADRYPAKDVRPNLVMGVNVQVCWEK
FCTFWEVEARQVPMEGDRYHLDPQAAAELCDENTIGVVGILGSTFDGSYEPVADLCAALD
ALQERTGLDVPVHVDGASGAMVAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWAL
WRDAEALPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQASRD
IARGLAERVEALGDFRLLTRGDELPVFAFTTADDVTAYDVFDVSRRLREGGWLVPAYTFP
PHREDLSVLRVVCRNGFSADMADLLVEELERLLPELRRQPHPLTRDKGAATGFHH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcaccaggctccccccacgtcccacgacgacgaccgtgaccggcgtcggctc
gccgtcaacccgttccacggcgcgaccaacccgctcggcgggatgaccgaggcaccgccg
gcccaccggctgcccgactccccgctgcccccggagacggcgtaccggctggtccacgac
gagctgatgctggacggcaacgcccgcctcaacctggccaccttcgtcaccacctggatg
gagccgcaggccggggtgctgatgggcgagtgccgggacaagaacatgatcgacaaggac
gagtacccgcgcaccgccgagctggagcggcgctgcgtgacgatgctcgccgacctgtgg
cacgcgcccgacccttcggcggtggtgggctgctcgacgaccgggtcgagcgaggcctgc
atgctggccgggatggcgctgaaacggcggtgggcgctgcgcaacgccgaccggtatccg
gccaaggacgtgcggcccaacctggtcatgggcgtgaacgtccaggtctgctgggagaag
ttctgcaccttctgggaggtcgaggcccggcaggtccccatggagggcgaccgctaccac
ctggacccccaggccgccgccgagctctgcgacgagaacaccatcggggtcgtcggcatc
ctcggctccaccttcgacgggtcctacgaaccggtcgccgatctgtgcgcggccctggac
gccctccaggaacgcaccggactcgacgtcccggtgcacgtcgacggggcctccggcgcc
atggtcgcgcccttcctcgacgaggacctggtgtgggacttccggctgccgcgggtcgcc
tcgatcaacacctcggggcacaagtacgggctggtctaccccggagtcggctgggcgctg
tggcgggacgcggaggcgctgcccgaggagctggtcttccgggtcaactacctgggcggc
gacatgccgaccttcgcgttgaacttctcccggcccggcgcccaggtggtcgcgcagtac
tacacgttcctgcggctgggccgggagggctaccgcgcggtgcagcaggcctcgcgggac
atcgcacgggggctcgccgagcgggtggaggcgctcggcgacttccggctgctgacgcgc
ggcgacgagctgccggtgttcgccttcacgacggccgacgacgtgacggcgtacgacgtg
ttcgacgtctcgcggcggctgcgggaaggcggctggctggtgcccgcgtacaccttcccg
ccgcaccgcgaggacctgtccgtgctgcgcgtggtgtgccgcaacggcttctcggccgac
atggccgacctgctggtggaggagctggagcggctgctgccggagctgcggcggcagccg
cacccgctgacccgggacaagggggcggcgaccgggttccaccactag

DBGET integrated database retrieval system