KEGG   Sinorhizobium americanum: SAMCFNEI73_pC0434Help
Entry
SAMCFNEI73_pC0434 CDS       T04621                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisphosphate carboxylase-like protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
same  Sinorhizobium americanum
Pathway
same00630  Glyoxylate and dicarboxylate metabolism
same00710  Carbon fixation in photosynthetic organisms
same01100  Metabolic pathways
same01120  Microbial metabolism in diverse environments
same01200  Carbon metabolism
Module
same_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:same00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAMCFNEI73_pC0434 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SAMCFNEI73_pC0434 (rbcL)
Enzymes [BR:same01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SAMCFNEI73_pC0434 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: APG94155
UniProt: A0A1L3LVN0
LinkDB All DBs
Position
C:472371..473627
Genome map
AA seq 418 aa AA seqDB search
MIRMTYRIETPGDVEAMAAKIASDQSTGTFVPVPGETEELKARVAARVVAIRHLGSSDCP
SWPEEAGEAKRFNRAEADIDFPLDAVGTDLSALMTIAIGGVYSIKGMTGIRVIGMRLPPE
FAAAHPGPQFGVAGSRRLTGVEKRPIIGTIVKPALGLRPEETAELVGDLISSGVDFIKDD
EKLMSPAYSPLKERIAAIMPRILDHEQKTGKKVMYAFGISHTDPDEMLRNHDLVVKAGGN
AGVVNINSIGMGGVAFLRKRSGIVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLIGVDQF
QINGIRVKYWEPDESFVKSFKAVSTPLFSERDCPLPVVGSGQWGGQAPQTYARTDGSTDL
LYLCGGGIVSHPGGAGAGVRAVRQAWEAAVAGIPLADYAKDHPELAQSLEKFSGGKGA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcatgacctaccgcatcgagacacccggcgacgtcgaggcgatggcggccaag
atcgccagcgatcagtcgaccggaaccttcgtgccggtcccgggcgaaactgaagagctg
aaggcacgggtcgcggccagggtggttgcgatcaggcatctggggtcaagcgactgtccc
tcatggccggaggaggcgggcgaggcgaagcgcttcaatcgggccgaggcggacatagac
ttcccgctcgatgcggtcggcacggatctctcggcgttgatgacgatcgccatcggcggc
gtctattcgatcaaggggatgaccggcattcgcgtgatcggcatgcgactgccaccggaa
tttgccgccgcccatcccggcccgcagttcggcgtcgcgggaagccgccggctgaccggc
gtcgagaagcgcccgatcatcggcaccatcgtcaagcccgcattgggcctgaggccggag
gagacggctgaactggtgggtgacctcatctcctccggcgtcgatttcatcaaggacgac
gagaaactgatgagcccggcctattcgccgctgaaggagcggattgccgcgattatgccg
cggattctcgaccacgagcagaagaccggcaagaaggtgatgtacgccttcggcatttcg
cacaccgatcccgacgagatgctgcgaaaccatgacctcgtcgtcaaagccggcggcaat
gccggagtcgtcaacatcaattcgatcggcatggggggcgtggcgtttctgcgcaaacgc
tccggaatcgtgctccatgcgcatcggaacggctgggatatcctcacccgccacggcggc
cttgggatggagttctccgtctggcagcagttctggcggctgatcggcgtcgaccagttc
cagatcaacggcatccgcgtcaaatattgggagccggacgagagcttcgtcaaatcgttc
aaggcggtcagcacgccgctcttttccgaacgcgactgcccgctgccggtcgtcggctcc
ggccagtggggcggccaggcgccccagacctatgcgcgcaccgacggctcgaccgatctg
ctttatctctgcggcggcggcatcgtcagccatccgggcggcgccggcgccggcgtcagg
gcggtgcgccaggcctgggaggcggcggtcgccggtatcccgctagccgactatgccaaa
gaccatccggaactcgcgcagtccctcgaaaaattttccggcggcaagggcgcctga

DBGET integrated database retrieval system