KEGG   Sinocyclocheilus anshuiensis: 107656905
Entry
107656905         CDS       T04917                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04115  p53 signaling pathway
sanh04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107656905
   04068 FoxO signaling pathway
    107656905
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107656905
   04115 p53 signaling pathway
    107656905
   04218 Cellular senescence
    107656905
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107656905
NCBI-ProteinID: XP_016300336
LinkDB
Position
Unknown
AA seq 141 aa
MCFLMQLEVMVMHKRILRALGNGVARWTLFGPVDREQLQLEYHDALRRDLEEASHRWGST
SPLRRLLWAETSSGRACPGSRCPSCTAPDLVPRTPKRYSIVPQNVEKTPEKRTELKRKQT
NITDFYLAKKRGVATPRKSGQ
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtgttttctgatgcagcttgaggtgatggtgatgcacaagcggatcctgcgggctctc
gggaacggcgtggcgcggtggaccctcttcggtcctgtggatcgcgagcagctccagctg
gagtaccacgacgctctgaggagagacctagaggaggcgtctcaccgctggggctcgact
tcgccactgagacgcctcttgtgggcggagacttccagtgggagggcgtgtccgggttca
aggtgcccgtcttgtaccgcgccggacctcgtccccagaaccccgaagagatacagcatt
gtcccgcagaacgtggagaaaacgccagaaaagaggaccgagctgaagaggaaacagacc
aatatcacagatttctacctggcgaagaagagaggggtggctacaccccgcaaatcagga
caataa

DBGET integrated database retrieval system