KEGG   Salmo salar (Atlantic salmon): 100196419Help
Entry
100196419         CDS       T04363                                 

Gene name
kith
Definition
(RefSeq) Thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00240  Pyrimidine metabolism
sasa00983  Drug metabolism - other enzymes
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    100196419 (kith)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100196419 (kith)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100196419 (kith)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 100196419
NCBI-ProteinID: NP_001134920
UniProt: B5XF49
LinkDB All DBs
Position
ssa02
AA seq 243 aa AA seqDB search
MDIVTQKVNLMECLNVPRILPNSPRKAIGQIQVIFGPMFSGKSTELIRRVRRFQIAQYNC
LVVKYAKDTRYSEKGMATHDKNTMEAVPANCLSDVRSLALQACVIGIDEGQFFPDTVEFC
EEMANMGKTIIVAALDGTFQRKPFGNILNLVPLAESVVKLNAVCMQCYKEAAYTKRLGAE
KEVEVIGGADMYHARCRKCYGGLMDVMKENSAPHRDETPPHVMTEKLLDNTTSPRKLLAT
LQL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggatattgtgacgcagaaagttaacttaatggagtgtttgaatgttccaagaatcctg
ccaaattccccacgaaaagcaataggacagatccaggtcatctttggcccaatgttctca
ggcaaaagcactgagttgataaggcgagtgcgtcgtttccagatcgctcagtacaactgt
ttggtggtcaaatatgccaaagatacacgctactccgagaagggcatggccacgcatgac
aaaaacacaatggaagccgtaccagccaactgcctgagtgacgtacgttctctagctctg
caggcttgcgtcatcggaatcgacgaaggacagtttttcccagacaccgtggagttctgt
gaggagatggccaacatggggaagactataatcgtagcggccctggatggaaccttccag
agaaagccctttggaaacatcctgaacctggttcccctggctgagagcgttgtgaagctg
aacgctgtctgtatgcagtgttacaaggaggcagcatacactaagagactgggggcagag
aaagaggtggaggtgattggtggagctgatatgtaccatgcgcggtgcaggaagtgttac
ggtggcttgatggatgtgatgaaggagaatagcgccccccacagggacgagacaccaccg
catgtgatgacagagaaactgcttgacaacactacatcgccacggaaactcctcgccacc
ctgcaactctga

DBGET integrated database retrieval system