KEGG   Salmo salar (Atlantic salmon): 100196817
Entry
100196817         CDS       T04363                                 

Gene name
gorab, ntbp1
Definition
(RefSeq) golgin, RAB6 interacting
  KO
K19748  RAB6-interacting golgin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100196817 (gorab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    100196817 (gorab)
Membrane trafficking [BR:sasa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    100196817 (gorab)
SSDB
Motif
Pfam: Transcrip_act
Other DBs
NCBI-GeneID: 100196817
NCBI-ProteinID: XP_013978993
UniProt: A0A1S3KK20
LinkDB
Position
ssa10
AA seq 294 aa
MAGWSGFSEEELRKLQQKDQAVPAALGRGRKPAPTNRSRQQLQRERALQLATQQKSGPGS
SALPPEQQLTKPPPQPTKALPQAVIQPVVTPTKPVEEPSQKETLAVNHAPAPAEDTPPIA
KELEKQEVEFREKTRIELLQQDQKMMEERNKRKKALLTKTIAEKSKQTQAESVKLKRIQK
ELQTLDNMVSNDICILRGVIEQASWDYNTARKRYEKAESEYVTAKLDLHKKTEIKEQLTE
HLCAIIQQNELRKAHKLEELLQQLHLQATEEEQEEEREEERKREEERKREEERK
NT seq 882 nt   +upstreamnt  +downstreamnt
atggcaggatggtcagggttttcggaagaggagttacgaaagttgcagcaaaaagaccag
gcggtgcctgcggctttaggtcgtggacggaaaccagctcctactaaccggagtcggcag
cagttgcagcgagagagagccctccagttagccactcagcaaaagagtggacccggctcg
tctgcgctaccacccgagcagcagctaaccaagcctccgccgcagcccactaaggccctg
ccgcaggctgtcattcagcccgttgtcacccccacaaagccggtggaggaacccagccaa
aaagagacccttgccgtaaaccatgctcctgcaccagcagaggacacaccgccgattgcc
aaggagttggaaaaacaagaggtggaatttcgggagaagactcgcatagagctgcttcag
caagaccaaaagatgatggaagagaggaataagcgcaagaaagccctcctgaccaagacc
atcgctgagaaatccaaacagacccaggcagagtcagtgaagctgaagaggatccagaaa
gagttgcagactctggacaatatggtgtccaatgacatctgcattctgagaggtgtgata
gagcaggccagctgggactataacactgcaaggaagcgctatgagaaggcggagtctgag
tatgtgacggccaagctggacctccacaagaagacggagataaaggagcagctgacggag
cacctgtgtgccatcatccagcagaatgagctccgcaaggcccacaagctggaggagctg
ctgcagcaactacacctccaggccacggaggaggaacaggaagaggagcgggaggaggag
aggaagcgggaggaggagaggaagcgggaggaggagaggaag

DBGET integrated database retrieval system