KEGG   Salmo salar (Atlantic salmon): 100196882
Entry
100196882         CDS       T04363                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100196882 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100196882 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    100196882 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    100196882 (fgf1)
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   100196882 (fgf1)
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100196882 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100196882
NCBI-ProteinID: NP_001135376
UniProt: B5XGR3
LinkDB
Position
ssa05
AA seq 159 aa
MTDAEITFLPVGQDNERFGSNLLDNKKLTRLYCMNGGHHLQILPDGTVEGKRDENDVHTV
LRVKSVDHGVVVIQGTEAGRYLAMSSEGKLYSSSIVTDQCYFLEKMEVNHYNTYQAQKYQ
DRSWYVGLKKNGKPKLGSRTHIGQKAIFFLPRRLEGTGE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgacggatgcagaaataacgtttttaccggtggggcaggataatgagagattcggaagt
aacctgctcgacaataaaaagctgacccgcctatattgcatgaatggcggacatcatctg
cagattctcccggatgggaccgtggaaggcaagagggacgagaatgacgttcacacggtc
ctgagggtgaaatctgtggaccatggtgtggttgtcatccaggggacagaggcaggacgc
tacttggccatgagcagtgaaggaaagctatacagttcatcgatagtaactgatcagtgt
tatttcctggagaagatggaggtgaaccactacaacacctaccaggcccagaagtaccaa
gacaggagttggtacgtgggactgaagaagaacgggaaacccaaacttggctccagaacc
cacatagggcagaaggccatcttcttcttgccacggcggttggaaggcacaggggagtga

DBGET integrated database retrieval system