KEGG   Salmo salar (Atlantic salmon): 100380779
Entry
100380779         CDS       T04363                                 

Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100380779
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    100380779
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sasa03310]
    100380779
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100380779
Nuclear receptors [BR:sasa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100380779
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100380779
NCBI-ProteinID: XP_014053534
UniProt: A0A1S3RP97
LinkDB
Position
ssa04
AA seq 752 aa
MDPGGLKHSINKDKGLAFGKLSESGVEGSFSGDAGGSKSTTSTSLMHLPGSRPQPPARDS
ANGLNVTTTQMELSTGGLTIEESEVKVMEKALRMQQPQKPQQNQQLFENFALLEASIADL
NRSNTPGSSVLERPHDLFSLKTEKDRLDMGSVSFGQSQKDLDVNERLLGDNTMDILQDLD
LPGSLSDLNEFYVSDEAAFLSSLSVEDVLLEDGNMETKPIDCSNGGNCTNVDSADQQKQL
LEPGISMPVIKTEEDADTSFIQLCTPGVIKQENDRRSYCQISSLDLPSTHNSVGSMSGPS
YPYGANTSTAVSLQQDQKPVFGLYPPLPSVSDSWNRGNGYGAGSGMSSSSFPVGFSSPTA
RPEASGSTSSAKPSGPTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGWRARQNTDG
QHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKNKKLIRLKGQQTTMEPSPP
PPDERACALIPKSMPQLVPTMLSLLKAIEPEAIYSGYDSTIPDTSTRLMTTLNRLGGQQV
VSAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGGMLCFAPDLVIND
ERMKLPYMTDQCEQMLKISTEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRM
TYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMQEMVGGLLQICFYTFVNKSLSVEFPE
MLAEIISNQLPKFKDGSVKPLLFHALNHDTMP
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggatccaggtggactgaaacacagcattaacaaggacaagggcttggctttcggtaaa
ctctcagagagcggtgtagaaggaagcttctcgggtgacgcaggtggttccaagtccacc
acatcaacctccctgatgcatctgccaggctccagaccccagccaccagccagagactcc
gccaacggactgaatgtcactacgactcagatggagctctccacagggggactcactata
gaggagtctgaagtgaaggtaatggagaaggcccttagaatgcagcagccacagaaaccg
cagcagaaccaacagctgtttgagaactttgctctgttggaggcgagtattgcagatttg
aatcgatccaacaccccagggagctctgtacttgaacgccctcatgaccttttctctctg
aaaacggagaaggacaggcttgacatggggtcagtcagctttggacagtcacagaaggac
ttggatgtcaacgagaggctccttggcgacaatacaatggacattctgcaggatttggac
ttgcctggctctctgtctgacctgaatgagttttacgtgtctgatgaggctgctttcctt
tcctccctgtcagtggaggatgtcctgctcgaggacggcaacatggaaaccaagcccata
gactgtagcaatgggggaaactgtacaaatgtggacagcgcggaccagcagaagcagctt
ctggagccaggcatctccatgcctgtcatcaagacggaggaggatgctgacacctccttc
atccagctttgcaccccaggggtcatcaagcaagagaatgatcgtcggagctattgtcag
atatccagcctggacttgcctagtacccacaactcggtgggttccatgagcgggccgagt
tacccctatggagcaaacacctcgacggcagtgagtctacagcaggatcagaagcctgtc
tttggcctgtatcccccactgccctcagtcagtgacagctggaacagaggcaacggatac
ggggctggatcagggatgtcgagctcatcttttcctgtcggcttcagcagtccaacggcg
agacccgaggccagcggctccacatcgtcagccaagcccagcggtccaactcataagatc
tgcttggtgtgttcggacgaggcgtctggttgccactatggagtcctcacctgcggaagc
tgcaaggtcttcttcaagagggccgttgaaggatggagagcacgacaaaacacagatgga
caacacaactatctgtgcgctgggaggaacgactgcatcatagacaagatccgcaggaag
aactgcccggcgtgccgcttccgcaagtgtctccaagcagggatgaatctggaagcgagg
aaaaacaagaagctgatccgattaaaaggtcagcagacgacgatggagccgagccctccc
ccacctgacgagagggcctgcgccctgatccccaagtccatgccccagctggtacccacc
atgctgtccctgctcaaagccatcgagccggaggccatttactctggctacgacagcacc
attcccgacacctccacccgcctcatgaccaccctcaacaggctgggcggacagcaggtt
gtctcagccgtcaaatgggccaagtccctaccagggttccggaaccttcacctggatgac
cagatgaccctgctgcagtgctcctggctgttcctcatgtcgttcggcttgggctggcgc
tcctaccagcagtgtaacggagggatgttgtgcttcgcccctgacctggttattaatgat
gagaggatgaagttgccttacatgaccgaccagtgtgagcagatgctgaagatctccact
gagtttgtgaggctgcaggtgtcttatgacgagtacctgtgtatgaaagtcctgctgctg
ctcagcacagtaccaaaggatggattgaagagccaggctgtgtttgatgagatccgcatg
acctacataaaggagctggggaaggccatcgtcaagcgggaagagaactccagccagaac
tggcagaggttctatcaacttactaagctactggactccatgcaagagatggtggggggc
ctcctgcagatctgtttctacacatttgtgaataaatccctgagcgtggagttcccggag
atgctggctgagatcatcagcaaccagttaccgaaattcaaagatgggagcgtcaagccc
cttctgtttcatgccttaaaccatgacacaatgccttaa

DBGET integrated database retrieval system