KEGG   Salmo salar (Atlantic salmon): 100380816
Entry
100380816         CDS       T04363                                 

Gene name
ctnnb1, ctnb1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100380816 (ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100380816 (ctnnb1)
   04520 Adherens junction
    100380816 (ctnnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100380816 (ctnnb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100380816 (ctnnb1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100380816
NCBI-ProteinID: NP_001167409
UniProt: C0HAA3
LinkDB
Position
ssa02
AA seq 780 aa
MASQSDLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDNQ
VLYEWEQGFSQSFTQDQVSDIDGQYAMTRAQRVRAAMFPETLDEGMQLPSTQFDGAHPTN
VQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKK
EASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALV
KMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCL
QILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAG
GMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAA
GILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQDAEMA
QNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLV
RAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQ
LLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFR
MSEDKPQDYKKRLSVELTSSLFRTEPMTWNETGDLGLDIGAQGDALGYRQEDPSYRSFHS
GGYGQDSMGMDSMMDHDMGAHHPGPEYPVDGLPDLGHAQDLIDGLPPGDSNQLAWFDTDL
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggcttcccagtctgatctgatggagctggacatggccatggagcctgaccgaaaggct
gcagtgagccactggcagcagcagtcatacctggactctggtatccactcaggggctacc
accaccgccccctccctgagtgggaagggcaacccagaggaggaggatgtggataaccag
gtgctgtacgagtgggagcagggcttctctcagtccttcacacaagaccaagtgtcagac
attgatgggcagtatgccatgaccagagcccagagggtgcgtgcggccatgtttccagag
accctggacgagggcatgcagctcccctccacccagtttgatggggcccacccaaccaac
gtgcagcggctggctgagccctctcagatgctgaagcatgctgtggtgaacctcatcaac
taccaggatgacgcagagctggccacccgcgccatccctgagctgaccaaactactcaac
gacgaggaccaggtggtggtgaacaaggctgcagtgatggtacaccagctgtccaagaag
gaggctagccgccacgccatcatgcgctccccccagatggtgtcggcaatcgtgcgcacc
atgcagaacaccaacgatgtggagacagcccgctgcaccgccggcaccctgcacaacctg
tcccaccacagagagggtctgctggccatcttcaagtctgggggcatccctgcccttgtc
aaaatgcttgggtccccagtggactcggtgctgttctacgccatcaccaccctacacaac
ctgctgctccaccaggagggtgccaagatggccgtgcgcctggccggcggcctgcagaaa
atggtggccttgctcaacaagacaaacgtcaaattccttgccatcacaacagattgcctt
cagatccttgcctacggcaaccaagaaagcaagcttatcatcctggccagcggtgggccc
caggccttggtcaacatcatgaggacctacacatatgaaaagctgttgtggactaccagt
agagttctcaaagtgctctctgtctgctccagcaacaagcctgccatcgtagaggctggt
ggtatgcaggcacttgggcttcacctcacagaccccagtcagagactagtccagaactgc
ctgtggaccctcaggaacctgtcagacgctgccaccaaacaggagggtatggaaggtctg
ctggggaccctggtccagctcctgggctctgatgacatcaacgtggtgacgtgtgctgcc
ggcatcctgtccaacctcacctgcaacaactacaagaacaagatgatggtgtgtcaggtt
ggggggattgaggcactggtccgtaccgtgctgcgtgccggagaccgcgaggacatcact
gagccggccatctgcgccctgcgccacctcaccagccgccaccaggatgctgagatggcc
cagaatgccgtgcggcttcactacggcctgcctgtggtggtcaagctgctgcatcccccc
tcccactggcccctcatcaaggccactgtgggcctaatccgtaacctggctctgtgtcca
gccaaccatgcccctctgcgtgagcagggggccatccccagactggtgcagctgctggtc
agagcccaccaggacacccagagacgcacctccatgggaggcacccagcagcagtttgtg
gagggagttcgtatggaggagattgtggagggctgtactggagctctgcacatcctggct
agagacgtccacaacagaatcgtcatcagaggactcaacaccattccactctttgtccag
ctgttgtattctcccattgagaacattcagcgtgtggctgcaggagttctgtgtgagttg
gcccaggacaaggaggcagcggaggccatcgaggctgagggtgccaccgcccccctcaca
gagctgcttcactccagaaacgagggcgtggccacctatgctgctgccgttctgttccgt
atgtctgaagacaagccccaggactataagaagcgtctgtctgtggagctcaccagctcc
ctgttcaggacggagcctatgacctggaacgagacaggagatctgggcctggacatcgga
gctcagggagatgccctgggctaccgtcaagaagaccctagctatcgctccttccactct
gggggatatgggcaggactccatgggtatggactccatgatggaccatgacatgggtgcc
caccacccaggccctgaatacccagttgacgggctgcccgacctgggccacgcccaagac
ctgatcgatgggcttcccccaggcgacagcaatcagttggcttggtttgatactgacctg
taa

DBGET integrated database retrieval system