KEGG   Salmo salar (Atlantic salmon): 100380849
Entry
100380849         CDS       T04363                                 

Gene name
mtor, frap
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04136  Autophagy - other
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04371  Apelin signaling pathway
sasa04910  Insulin signaling pathway
sasa04920  Adipocytokine signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100380849 (mtor)
   04371 Apelin signaling pathway
    100380849 (mtor)
   04150 mTOR signaling pathway
    100380849 (mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100380849 (mtor)
   04136 Autophagy - other
    100380849 (mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    100380849 (mtor)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100380849 (mtor)
   04920 Adipocytokine signaling pathway
    100380849 (mtor)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100380849 (mtor)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100380849 (mtor)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    100380849 (mtor)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100380849 (mtor)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100380849 (mtor)
Membrane trafficking [BR:sasa04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100380849 (mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 EPSP_synthase Coatomer_E Nipped-B_C HEAT_EZ
Other DBs
NCBI-GeneID: 100380849
NCBI-ProteinID: XP_014001607
UniProt: A0A1S3MEK7
LinkDB
Position
ssa15
AA seq 2524 aa
MVIMSGTATVLQQFVSGLKSRNEDTRAKSAKDLQHYVTTELRELSQDEATTFYDELNHHI
FELVSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDSVVMEMASKAMG
HLSMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFF
DNIFYAVWDQKQAIREGAVAALRACLILTTQRETKEMQKPQWYKQTFDEAEKGFDETLSK
EKGMNRDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDRYCKELLGFGTKPR
HITPFTSFQSVQPQQSNALLGLLGYSTPQGFLSFGATPVPAKSSLVESRYCRELMEECFD
QVCRWVLKYRTSKNPLIQMTILNLLPRLAAFQPHTFTVEVCPLPDQYLADTMGYLLGCLK
KEKERTAAFQALGLLVVAVRAEIQPYLTKILEIIKAALPPKDFAHKRQKTMQVDATVFTC
ISMLSRAMGPSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSL
VLMHKPLRHPGMPKGLAQQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRH
CADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHGHVVSQTAVQVVADVLSKLLVVGIT
DPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAF
VMPFLRKMLIQILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKD
PDPNPGVVISVLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQ
VASTGYVVEPYRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMID
QSRDASAVSLSESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNH
HTMVVQAVTFIFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHI
RPYMDDIFTLIREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDMS
MGRGVTIKLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPLQARKVALETLDRLTESLD
FTDYASRIIHPIVRALDNTPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQ
RYDVLICRIVKGYTLAEEEEDPLIFQHRQLRSNQGDVGSGPAEAGPMKKLHVSTTALQKA
WGAARKVSKDDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSE
LSEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAA
KCRAYAKALHYKELEFQKGASPLILESLISINNKLQQPEAASGVLEYAMKHFGELEIQAT
WYEKLHEWEDALVAYDKKIDINKDDPELILGRMRCLEALGEWGQLHQQCCEEWTLVTEDT
QAKMARMAAAAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKAR
DLLDAELTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRDTWWERLQGCQR
IVEDWQRILMVRSLVINPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHP
LPTAHPHVTYAYMKYMWKSQHKIEAFQHMQHFVQGMQQQAQHAIAAEDQQHKQELHKLMA
RCFLKLGEWQLSLQGINESTIPKVLQYYNHSTEHDRNWYKAWHAWAVMNFEAVLHYKHQN
QGRDEKKKKRHVSGTSANSEASNSDSEVDSTEHSPVPSPGQKKANEDLSKTLLLYTVPAV
QGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIAR
IDTPRALVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTL
VQQAIMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTL
KETSFNQAYGRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQY
VSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTIMGSNGHEFMFL
LKGHEDLRQDERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDT
LHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWL
KSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVA
MTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDP
LLNWRLMDTNTKGNKRSRTRTDSYTAGQSVEALEGIDLGETTHKKPGTTVPESIHSFLGD
GTVQPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGW
CPFW
NT seq 7575 nt   +upstreamnt  +downstreamnt
atggttatcatgtctggcacagccactgtgctgcaacaatttgtcagtggcctgaagagt
cgaaatgaagacacaagagcaaaatctgcgaaagatctccagcactatgtgacgacagag
ctcagagagttgagccaagatgaagccaccactttctacgatgaattgaatcatcacatt
tttgagctggtttccagctctgatgtgaatgagaaaaaaggagggattcttgctatagtg
agtctgattggagtagaaggaggcaatgccacccgaatcagccgcttcgccaactacctc
cgcaacctgctgccctccagtgactcggtggtcatggagatggcttcaaaggccatgggc
cacctgtccatggcaggggacaccttcaccgcagagtatgtggagtttgaggtgaagagg
gcactggagtggctgggcgccgacaggaacgagggcaggcgccatgctgcggttcttgtc
ctaagggagttggctgtcagcgcacccacctttttcttccagcaagtccagccctttttc
gacaacatcttctatgcggtgtgggaccagaagcaggccatccgcgaaggggccgttgcc
gctctcagggcctgcctcatcctcactacccaacgagagaccaaggagatgcagaaacca
cagtggtacaaacaaacctttgacgaggctgagaaaggcttcgatgagaccttgtccaaa
gagaagggtatgaaccgtgacgatagggtccatggcgccctcctcatcctcaacgaactg
gtccgcatcagcagcatggaaggagagcgcatgcgggaggagatggaggagatcacccag
cagcagctggtccacgacaggtactgcaaggagctgttgggcttcggcaccaagccacgt
cacatcacccccttcaccagctttcagtcagtgcagccgcagcagtccaatgccctgctg
ggtctcttgggctacagcacaccccagggcttcctcagcttcggggccacgccggtgccc
gccaagagctccctggtggagagccgctactgccgcgagctcatggaggagtgctttgac
caggtgtgccgctgggtgctgaagtacaggaccagtaagaaccctctgatccagatgacc
attctcaaccttctgccgcgcctcgccgctttccagccacacacctttacagttgaagtt
tgccccctcccagaccagtacctggctgacaccatgggctacctgcttggctgtctgaag
aaggagaaggagcgcacagcggccttccaagccctggggctgctggtggtggcggtacgc
gctgagatccagccctacctcaccaagatcctggagatcatcaaggctgcgctgcccccc
aaggacttcgctcacaagagacagaagaccatgcaggtggatgccacagtgttcacctgt
atcagtatgttgtccagagccatgggccccagcatccagcaagacatcaaggagctgctg
gagcccatgctggccgtgggactcagcccggccctgacggcggtgctgtacgacctgagt
cggcagatcccccagctaaagaaagacatccaggacggcctgctgaagatgctctccctg
gtgctcatgcacaagcccttacgccacccgggcatgcccaagggcctggcgcaacagctg
gcatcgcccagcctcaccaacatccccgaggccagtgacgtgggcagcatcactctggca
ctcaggacactgggcagctttgaatttgaaggccactcgctgacccagtttgtgcgccac
tgcgccgaccacttcctcaacagcgagcacaaggagatccgcatggaggcagcgcgcacc
tgctcccgcctgctgacgccctccatccatctgatcagcggccatggccatgtggtcagc
cagacggccgtgcaggtggtggccgacgtgctcagcaagctgctggtagtcggcatcaca
gatccagacccagatatccgctactgtgtgctggcctctctggacgagcgcttcgacgcc
cacctggcgcaggcggagaacctgcaagctctgttcgtggcgctgaacgacgaggtgttt
gagatcagagaactggccatctgcaccatcggacgcctcagcagcatgaaccccgccttc
gtcatgcccttcctgcgcaagatgctcatccagattctgactgagctggagcacagtggc
gtgggcaggaacaaggagcagagtgcccgcatgctgggtcacctggtttccaacgccccc
cgcctcatacgcccatacatggagcccatcctaaaggccctgatcctgaagcttaaagac
ccagaccccaaccctggagtggtcatcagtgtcctggccactattggagagttggctcag
gtgagcggactcgagatgaggaagtggatggacgagctcttccccatcatcatggacatg
ctccaggactcctcctcattggccaagagacaggtggcgctatggactttgggccagcag
gttgctagcactggatacgtggtggagccctaccgcaagtacccctctcttctggaggtt
ctgctcaactttctcaagacagagcagaaccaggggatcagaagagaggctatccgtgtg
ctgggcttgctgggagccctggacccctacaagcacaaggtgaacattggcatgatcgac
cagtcacgagacgcttctgccgtcagcctctccgagtccaagtccagccaggactctgcc
gactacagtaccagtgagatgctggtgaacatgggcaacctccccctggacgagttctac
ccggcggtggccatcgtgacgctgatgcgcatcctgcgggacccctccctctctaaccac
cacaccatggtggtgcaggcggtcaccttcatcttcaagtccctgggcctgaagtgtgtc
cagttcctgccgcaggtcatgcccaccttcctcaacgtcatccgcgtgtgcgacgctagc
atccgagagtttctattccagcagatggggatggtcgtgtgctttgtgaaaatccacatc
cgcccctacatggatgacatcttcacactcatcagagagtactggacacctaacaacccc
atgcagaacaccatcatcctgctgattgagcagatcgtggtggccctgggcggcgagttc
aagctctacctgccgcaactcatcccacacatgctgcgtgtcttcatgcacgatatgagc
atgggccgcggcgtcaccatcaagctcctcaatgccattcagctgtttggtgctaacctg
gacgactacctccacctgttgctgcctcccatcgtcaagctgtttgatgccccagacgta
cctctacaggcccgcaaggttgccttggagacgctagaccggctgacggagtccctggac
ttcacggattatgcgtcgcgcatcattcaccccatagtacgtgcgctggacaacaccccc
gagctacgcagcacagccatggacacgttgtcgtcgctcgttttccagctgggcaagaag
taccagatctttatccccatggtgaacaaagtgatgttgaagcacaggatcaatcaccag
cgctatgacgtgctcatctgtcggatcgtcaaggggtacactttggcggaggaggaagag
gatcctttaatcttccagcatcgccagctgcgcagtaaccagggcgatgtcggtagcggc
ccggcagaggcggggccgatgaagaagctccacgtcagcaccacagccctgcagaaggcc
tggggcgccgctcggaaggtgtccaaggacgactggctggagtggctgagacggctgagc
gtggtcctgctgaaggagtcgtcgtcccctgccctgcgctcgtgctggtctctggcccaa
acctacattcccctcgccagggacctgttcaacgcagccttcctgtcatgctggtctgag
ctgagtgaggatcagcaggatgagctgatccgcagcatcgaactggccctcacctcccag
gacatcgccgaggtcacccagaccctgctaaacctggctgagttcatggagcacagcgat
aagggtcctctgcctctgagagacgacaatggcattgttctgctgggtgagagggctgcc
aaatgtcgtgcctacgccaaggccctccactacaaagagctggagttccagaagggcgcc
tctcctctcatcctagagtccctcatcagcatcaataacaaactgcagcagccagaggca
gcatccggggtcctggagtatgccatgaagcactttggcgaactggaaatccaggccacc
tggtatgagaagctccacgagtgggaggacgctctggtggcgtacgacaagaagatcgac
atcaacaaggatgaccctgagctgatcctggggcgcatgcgctgcttggaggccctgggc
gaatggggccagttgcaccagcagtgctgtgaggagtggactctggtcactgaggatacg
caggccaagatggcccggatggcagccgctgcagcctggggtctaggccactgggacagc
atggaggagtatacatgtatgatccccagggacacacacgatggagccttctacagggcc
gtgctcgctctgcatcaggacctcttctcattggctcagcagtgtatcgacaaggccaga
gatctactggatgcggagctgacagccatggctggagagagttacagcagagcgtatggg
gccatggtgtcgtgtcagatgctgtcagagctggaagaggtcatccagtacaagctggtc
ccggagaggagggacatcatccgagacacctggtgggaaaggctacagggttgccagcgg
atagtggaggactggcagaggatcctaatggttcgctcgctggtcatcaacccccacgag
gatatgcggacctggctcaagtacgccagtctctgtggcaagagtggacgtctggcgttg
gcccacaagaccctggtccttctcctgggggtggacccctcaaagcagctggaccacccg
ctgcccaccgcccacccccacgttacctatgcctacatgaagtacatgtggaagagccaa
cacaagatcgaagccttccagcacatgcagcactttgtccaggggatgcagcagcaggcc
cagcatgccatcgccgccgaggaccagcaacacaagcaggagctccataagcttatggcc
aggtgcttcctgaagctgggtgagtggcagctcagtctccagggcattaacgagagcacc
atccccaaagtgttgcagtactacaaccactccacggagcacgaccgcaactggtacaag
gcctggcacgcatgggcggtgatgaactttgaggcggtgctgcactacaagcaccagaac
cagggccgggacgaaaagaagaagaagcgccacgtcagcggcaccagcgcaaatagcgag
gccagcaacagcgacagcgaagtagacagcaccgagcacagccctgtgccctcgccgggc
cagaagaaggccaacgaggacctctccaagacgttactcctctacacggttcctgctgtc
cagggctttttccgctcaatctccctctccagagggaacaacctccaggacaccctcagg
gtcctgaccctctggtttgactatggacactggcctgaagtcaacgaggcgttggtggag
ggcatcaaaaccattcagatagacacctggctacaggtgatcccccagctgattgcccgc
atcgacactccccgtgctctggttggccgcctcatccaccagctgctcaccgacattggg
cgctaccacccccaggctttgatctatccgttgaccgtggcctccaagtcaaccaccact
gcccgccacaatgctgctaacaagatcctcaagaacatgtgtgagcactgcaatacactg
gtccaacaggcgatcatggtgagcgaggagctgatccgggtggccattctgtggcacgag
atgtggcacgagggcctggaggaggcctcccgcctctactttggcgagcgcaacgtgaag
ggtatgttcgccgtgctggagccccttcacgccatgatggagaggggcccgcagaccctc
aaagagacctccttcaaccaggcctacgggagggacctcatggaggcccaggattggtgc
aggaagtacatgcgctcaggcaacgtgaaggacctgacccaagcatgggacctgtactac
cacgtcttcagacggatctccaagcagctaccacagttgacctccttggagctgcagtac
gtgtcccccaagctgctgatgtgcagggacctggagctggctgtgccggggacctatgac
cccaaccagcccatcatccgcatccagtccatcgccccctcgctgcaggtcatcacctcc
aagcagcggccgcgtaaactcacaatcatgggcagcaatggccatgagttcatgttcctc
ctgaagggccatgaggacctgcggcaggacgagagggtcatgcaactctttggcctggtc
aacacactgctggccaatgacccagcctctctacgtaaaaacctcagcatccagcgctac
gcggtgattcccctgtccaccaactctggtctaattggctgggtgcctcactgtgacacc
cttcacgccctcatcagagactaccgggagaagaagaagatcctgctcaacattgagcac
cgcattatgctcaggatggctccagactatgatcacctgaccctgatggagaaggtggag
gtgtttgagcacgccgtcaacaacacggctggagacgacctggccaagctgctgtggctg
aagagccccagctctgaggtttggtttgacaggaggaccaattacacacgctccctggct
gtgatgtcaatggtgggctacatcctgggcctgggagacaggcatccatccaacttgatg
ttggacagactaagtggcaagatcctccacattgattttggggattgctttgaggttgcc
atgaccagggagaagttcccggagaagattcctttcagactgacaagaatgctgacgaac
gccatggaggtgacaggtctggatgggaactacaggatcacatgtcacacggtgatggag
gtgctgagggagcacagggacagtgtcatggccgtactggaggccttcgtctacgaccca
ctgctcaactggaggctgatggacacaaacaccaagggaaacaagcgatccaggaccaga
actgactcctacactgctggacaatcagtcgaagcactggaggggatcgaccttggtgag
accacacacaagaaaccaggaactaccgtgccggaatccattcattccttccttggagat
ggcacggtccagcctgaggccctgaataaaaaggctatccagattatcaacagagtacga
gacaagctgactgggcgggatttctcacacgatgagactctggatgtgccaacccaagtg
gagctcctcatcaagcaggcgacatcgcacgagaacctgtgccagtgttatattggatgg
tgtccattttggtag

DBGET integrated database retrieval system