KEGG   Salmo salar (Atlantic salmon): 106573979Help
Entry
106573979         CDS       T04363                                 

Definition
(RefSeq) B-cadherin-like
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04371  Apelin signaling pathway
sasa04514  Cell adhesion molecules (CAMs)
sasa04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106573979
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    106573979
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106573979
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106573979
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:sasa04515]
    106573979
   04090 CD molecules [BR:sasa04090]
    106573979
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106573979
Cell adhesion molecules [BR:sasa04515]
 Cadherins
  Major cadherins
   106573979
CD molecules [BR:sasa04090]
 Proteins
  106573979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_4 Big_9
Motif
Other DBs
NCBI-GeneID: 106573979
NCBI-ProteinID: XP_014004935
UniProt: A0A1S3MPB9
LinkDB All DBs
Position
ssa16
AA seq 618 aa AA seqDB search
MAYDITIFLIWGWVLGRMSETLQSGNGFDFPLTGGEETEEGFGHEDAGIVFQPKYPASLP
VLEFPKPLVGLVRRKRDWVVPPINFPENDRGPYPKIMVQIRSNNDKEMKIQYSITGSGAD
QPPVGLFIVDRNSGYLYVTQPLDRERQDKHLLLAHAVAVGAGIAEDPMEIIVRVIDMNDN
KPVFTLVPFKGLVPEASIPGFEFMQVTATDADEPGSANSDVRYTIINQEPELPSPNMFVM
NPVTGAIQVNAAGLDRENIPKYTLEIQAVDLEGNGLTSFGKSIITVADSNDIAPEFEKSS
NTVSVPENKVNALVVKMPVSDGDEPHSSNWATKYRIVDGDPGGMFTVSTGPSRLEGIITT
AKPLDFEKNNHYTLLVTVENEVPFATTLPTSTATVQVNVEDRNDVPVFDPVEKFFSVSEH
LPVDSDLVLYTAIDPDIMAHKLMYRMDRDPAKWLDINNETGMIKTKHPLDRESPFVKDGK
YRVVILAIKDEIPATGTGTILIELEDVNDNAPTIDDTPLKLCNQDPRLVHLAVTDRDGPG
FAEPFSVELLEGSNMYCTAQMDKTGTVVELTFKAMREQRNFYINLRVTDAGGLNQDHVIH
VTMNEDSCMTWRDFCVRP
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgacatcaccatcttcttgatctggggttgggtcctggggagaatgtctgag
actttacagtcaggtaatggctttgactttccactgactggaggggaagaaactgaggag
ggcttcggccatgaggatgctggcattgtctttcagcctaaatatcctgcaagtcttcca
gttctggagtttccaaagcctttggtaggtctggtgagaaggaaaagggattgggtcgtt
cctcccatcaacttcccagagaacgacagaggcccttaccccaagattatggtgcagatt
aggtccaacaatgataaagagatgaagatccagtacagcatcactggttctggagcagat
caaccccctgtgggactgttcattgtggacagaaactctgggtatctctatgtgacccag
cctttggacagagagagacaagacaaacatctgcttttggctcatgctgttgcagttggt
gcgggtatagcagaagaccccatggagatcattgttagagtaattgatatgaatgacaac
aagccggttttcactctagttccttttaaagggcttgtccctgaagcatccataccaggc
tttgagttcatgcaggtcacagccaccgatgcagatgagcctggctcagccaattctgat
gtcagatacactattataaatcaggaacctgaactgccgagtcccaacatgtttgtcatg
aaccctgtcacaggagcgattcaggtcaatgctgctggactggacagagagaatattcca
aaatatacattggaaatccaagctgttgatttggagggcaatggtctgacatctttcgga
aaatccattattactgtagcggacagcaatgacatagctcctgaatttgagaagtcttcg
aacacggtgtctgtcccagagaataaagtgaatgccctggtggtcaaaatgccagtgagt
gatggagatgagccacactcttccaactgggccaccaagtacaggattgtagatggagac
ccaggtggaatgttcactgtaagcactggacctagcagactggaaggaatcattaccaca
gccaagccccttgactttgagaagaacaatcactacaccctgttggtgactgtggagaat
gaggtcccatttgccaccaccctgcccacctccactgccacagtccaggtgaatgtggag
gataggaatgatgtccctgtctttgacccagtggaaaagtttttttccgtatctgaacac
ctgccagtggacagtgatttggttctgtatacagccattgatccagacatcatggcacat
aaactcatgtatcgcatggacagagatcctgctaaatggctggacatcaacaacgagacc
ggaatgatcaaaaccaaacaccccctggacagagaatctccctttgtcaaagatggcaaa
tacagagttgtcattctcgccatcaaagatgaaatccctgccactggaactggaaccatt
ctgatagagctggaagatgtaaacgacaatgctccgactattgatgacaccccgttgaag
ctctgtaaccaagacccccgtctagtgcatttagctgtgacagacagagacggtccaggc
tttgctgaacccttcagtgtagaacttctggaagggtccaatatgtattgcactgcccaa
atggacaaaacaggaactgtggttgaattaacattcaaggccatgagggagcagagaaac
ttctacattaatctgagggtcactgatgctggcgggctgaaccaagaccatgtcattcac
gtcaccatgaacgaggacagctgcatgacctggagggatttctgtgttagaccctga

DBGET integrated database retrieval system