KEGG   Salmo salar (Atlantic salmon): 106579080
Entry
106579080         CDS       T04363                                 

Gene name
erbb2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106579080 (erbb2)
   04012 ErbB signaling pathway
    106579080 (erbb2)
   04020 Calcium signaling pathway
    106579080 (erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106579080 (erbb2)
   04520 Adherens junction
    106579080 (erbb2)
   04530 Tight junction
    106579080 (erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106579080 (erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106579080 (erbb2)
   04090 CD molecules [BR:sasa04090]
    106579080 (erbb2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106579080 (erbb2)
Protein kinases [BR:sasa01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   106579080 (erbb2)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   106579080 (erbb2)
CD molecules [BR:sasa04090]
 Proteins
  106579080 (erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 106579080
NCBI-ProteinID: XP_014014092
UniProt: A0A1S3NFA0
LinkDB
Position
ssa19
AA seq 1306 aa
MEAARSFLFLRLLLVGLSGALGREVCLGTDMKLALPSSLENHYETLRLLYTDCQVVHGNL
EITHLRGKPDLSFLQGIVEVQGYVLIARVSVSVVPLDNLRIIRGSQLYNSSYALAVLDNT
LPQEGVGLRVLRLRSLTEILLGGVHIWGNHQLCFPDPQHMEWRDTLDEKNTHAKQLRLQA
RAPNCPKCSPACVKRSCWGETEKDCQTLTHVHCASGCLRCKGPDPNDCCHMQCAAGCTGP
KDSDCLSCRHFNDSGTCKDNCPPPTIYDPVTFVSKPNPNRKFSFGATCVKTCPYNYLAME
VACTMVCPKANQEVIITQPDGKETQTQKCDKCEGECPKVCYGLGMGDLQSSSWVSSSNVA
QFTGCNKIYGSLAFLPQSFTGDPLANMTGLTLSELDAFKDLVEITGYLYIDAWPANWTNL
SVFENLKVIRGRMLYKGVFSLGVQSIQIRSLGLRSLRSISGGLVLLHNNSQLCYTQDLPW
GTLLHPTQGPHRIVNANQDPQECVAEGRVCHLLCANGCWGPGPSQCVACVKFQRGKECVE
ECDIYQGSPREFFDSSERVCGACHSECRPINGSASCLGPGAHQCTDCLHYQDGEVCVEKC
PSGLKEEQHTVWKYSNATGHCLSCNTNCTLSCTQKDERGCPIHTKTGPGTSIAAAVGGAV
LFLILLGLLVFYLRRQKQLKRKETLRRILQEHELVEPLTPSGALPNQAQMRILKETELKK
LRVLGSGAFGTVYKGAWAPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVASPYV
CRLLGICLTSTVQLVTQLMPYGCLLDYVRENKDHIGSQYLLNWCVQIAKGMSYLEDVRLV
HRDLAARNVLVKNPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILHRKFTHQ
SDVWSYGVTVWELMTFGAKPYDLIPARDIPELLEGGERLPQPLICTIDVYMIMVKCWMIE
PDSRPKFKELVTEFSAMARDPPRYVVIQNDDKMSLSSPVDSQFFRMLLEEEGAEIRDLLD
AEEYLVPQPNFFRPQAETSGPNGPSRHHSHRSTDQGLDSEPSMAGGPRSMYSSVSTLGRS
QYPTLPMGASAISNGPWNPHYPSLLARTTSHLSTGGHSDSVFLDGGPDDAPASPGRYCKD
PTFPNGGESDLETDGPSPMHHYNHLNHHSLPRRGKAYNHNHALPEYINQEVQDLRPGAVE
RPSTLPRKGAAERHRHLPNGLSSGHSVENPEYLVPMMTPGSTSPAFDNPYYLDLVAKAVA
GGGGGGERDGGPNPPPRQVNDFVTPTAENPEYLGLADTWSGQREHT
NT seq 3921 nt   +upstreamnt  +downstreamnt
atggaggcggcgagaagttttctgtttctccggttactgctggtcggactttcgggcgca
ttgggcagagaagtgtgcctgggcacagacatgaagctggccctgccctccagtctggag
aaccactatgagacactgcggctgctctacactgactgccaggtggtgcacggcaaccta
gagatcacacatcttcggggcaagccggacctctccttcctacagggtatcgtggaggtg
cagggctacgtcttgattgcccgtgtgtctgtgagtgtggtgccgctggacaacctgcgc
atcatccggggaagccagctgtacaactccagctatgctctggctgtcctggacaacacc
ctccctcaagaaggggtgggcctgagggtgctccgcctccgcagtctcacagagatcctg
ctgggtggagtgcacatttggggaaaccaccagctctgtttcccagacccccagcacatg
gagtggagggacacactggatgaaaagaacacgcatgccaagcagctccgcctgcaggcc
cgggcccccaactgtccaaagtgctcccctgcctgtgtaaagcgaagctgctggggagag
acggagaaagactgccagaccctgacccatgtgcactgtgcatcggggtgtctgcgctgt
aagggacccgatcccaatgactgctgccacatgcagtgtgctgccggctgcactgggccc
aaagactcagactgcctgtcgtgccgtcactttaatgacagcgggacgtgtaaagacaac
tgtccgccccccaccatctacgacccggtcaccttcgtgtcaaaacccaaccccaacagg
aagttcagcttcggggccacctgcgtcaagacatgtccctataactacctagccatggag
gtggcctgtaccatggtgtgtcctaaagctaaccaggaagtgattatcacccagcctgac
ggcaaggagacacagacacagaagtgtgacaagtgtgaaggggaatgtccaaaagtgtgc
tatgggctgggcatgggtgatctccagagctcctcctgggtgagctcctccaacgtggcc
cagttcactggctgcaataagatctatggcagtctggctttccttccacagagcttcaca
ggggacccattggctaacatgacaggtctgacccttagtgagctggatgcatttaaggat
ttggtggagatcacaggatatctgtacattgatgcgtggccagccaactggactaacctg
agtgtgtttgaaaacctgaaagtgatccgaggaaggatgctctataaaggagtgttctct
ctgggggtccagtcaatacagatccgttctctgggtctgcggtcactcaggagcatcagc
gggggtctggtcctgctccacaacaactcccagctctgctacacccaggacctgccctgg
gggaccctgctgcaccccacccaggggccccaccgaatcgtcaatgccaaccaggacccc
caggagtgtgtggcggagggccgtgtgtgtcacctgctgtgtgctaatggctgctggggg
ccagggcccagccagtgtgtggcctgtgtgaaattccagcgtgggaaggagtgcgtggag
gagtgcgacatctatcaaggttccccgagggagtttttcgacagctccgagagagtctgt
ggcgcctgtcactcagagtgtcgccccatcaatggctctgcctcttgcctaggcccgggg
gcccaccaatgtacagattgcctgcactaccaggatggggaggtgtgtgtggagaaatgt
cccagtgggttgaaggaggagcagcacactgtgtggaaatacagcaacgccacgggccac
tgcctctcctgcaacaccaactgcacactctcgtgcactcagaaggatgaaagaggctgc
cccatccatactaaaacagggccgggcacttcgatcgcagctgcggtgggcggggcggtg
ctcttcctcatcctattgggtctgctggtgttctacctacgccgacagaaacagctcaag
aggaaggagacattgaggaggatcctccaggagcatgagctggtggagcctctgactccc
agcggagccctgcccaatcaggcccagatgcgcatcctcaaggagaccgagctaaagaag
ctaagagttctgggctcaggagccttcggcactgtctacaagggggcgtgggctcctgat
ggggagaatgtgaagatcccggtggccatcaaggttttgcgggagaacacctcgcccaag
gccaacaaggagatcctggatgaggcgtacgtaatggccggtgtggccagtccctatgtg
tgtcgtctgctgggcatctgcctgacctccacagtgcagctggtcacccagctcatgcca
tacggctgcctgctggactacgtccgagagaacaaggaccacatcggctcccagtacctc
ctcaattggtgtgtgcagatagcgaaggggatgagctacctggaggatgtgcgtcttgtg
cacagggacctggcagcacgtaacgtcctggtaaagaaccccaaccacgtcaagatcact
gacttcggcctggctcgcctgttggacatagacgaaacagagtaccatgctgacggaggc
aaggtgcctattaagtggatggcgttggagtctatcctccacaggaagttcacgcaccag
agtgatgtgtggagctacggggtgactgtttgggagctgatgacctttggggccaagccc
tatgacctgatcccggcacgagacatcccagagctgctggaggggggcgagaggctcccc
cagccccttatctgcaccattgacgtctacatgatcatggtcaagtgctggatgattgaa
ccagacagcaggcctaaattcaaggagctggtgacagagttcagcgccatggcacgagac
ccacctcgctacgtagtcatccagaatgatgacaagatgagtttgtccagtccggttgac
agtcagttcttcaggatgctactggaggaggagggagcagaaatcagagacctgctggat
gctgaggagtacctggtgccccagcccaacttcttcagaccccaagcggagacctcgggc
cccaacggcccctcacgacaccactcacacaggagtacggaccagggattggacagcgag
ccctccatggcgggcggcccgagaagcatgtactcctcggtgagcaccctggggcgcagc
cagtaccccactctgcccatgggggccagcgccatctccaacgggccctggaacccccat
tacccctccctcctggcccgcaccacctcacacctctctacggggggacactcggactct
gtgttcctggacgggggtcccgatgacgccccagcgagccccgggcgctattgcaaagac
cccaccttccccaatggaggagagagcgacctggagacggatggaccgtcaccgatgcat
cattataatcatcttaatcatcactcgctgccccgtaggggtaaagcgtataatcataat
cacgcgttaccagagtacatcaaccaggaggtgcaggacctccggccaggggccgtcgag
cgccccagcaccctgccccgcaagggggcagccgagaggcatcggcacctccccaatggc
ctgagctcgggacacagcgtggagaacccagagtacctggtccccatgatgacccccggc
tccacctcgcctgccttcgacaatccctactacctggacctggtggctaaggctgtggcc
ggagggggtggtggtggggagagggatgggggccctaaccctcctcccaggcaggtgaat
gactttgtgacgcccacggcagagaacccagagtacctgggcctagcagacacctggagc
ggccagagagagcacacctga

DBGET integrated database retrieval system