KEGG   Staphylococcus aureus subsp. aureus 55/2053: SAAG_00867Help
Entry
SAAG_00867        CDS       T02810                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
saua  Staphylococcus aureus subsp. aureus 55/2053
Brite
KEGG Orthology (KO) [BR:saua00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAAG_00867
Enzymes [BR:saua01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SAAG_00867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 Thi4 DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 K_oxygenase NAD_binding_9 NAD_binding_8 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: EEV05643
LinkDB All DBs
Position
complement(376278..377801)
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLKQLLELMEGNVEFVASLGSDDKSKELKELLTEISDMSPRLSLSEKSLKRT
PSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKNLEGSFHFE
TFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESENIMAVPAVFLNGEEFGNG
RMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENG
AVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIKTNAKTTEVVGENHVTGIRYED
MSTGEEHLLNLDGIFVQIGLLPSTSWLKDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaaacaacaacttaaacaactattagaactaatggagggcaac
gttgaattcgttgccagccttggttcagatgataaatctaaggaactcaaagaattatta
acagaaatttctgatatgtcacctagactttcactttctgaaaagtctttaaaacgtaca
ccaagtttctcagtcaatcgtcctggcgaagaaacaggtgtaacatttgcaggtattcca
ttaggtcacgagtttaactcacttgttttagcaattttacaggttagtggtcgtgcacct
aaagaaaaacagtcaatcattgaccaaattaaaaacttagaaggttcattccattttgaa
acattcattagtttaacgtgtcaaaaatgtcctgatgtcgttcaagcacttaacttaatg
agtgtgattaaccctaacatcacgcattctatgattgatggtgcagtgttccgtgaagaa
tctgaaaacatcatggcagtccctgctgtctttttaaatggcgaagaatttggcaatggt
cgtatgacaatccaagatattctttcgaaactaggcagtacggcagatgcatctgagttt
gaaaacaaagaaccttatgatgtcttaatcgttggtggtggtcctgctagtggtagtgca
gcgatttacacagcacgtaaaggtttacgtactggtatagttgctgatcgtatcgggggc
caagttaatgatactgctggtattgagaacttcattactgttaaagaaacaactggttct
gaattttcttctaacttagcagcgcacattgatcaatatgacattgatgcaatgacaggc
attcgtgctacagatatcgaaaagactgacgaagcaattaaagttacgttagaaaacggt
gctgtcctagaaagtaaaacagtcattattgctactggtgcaggttggcgtaagctaaac
attccaggtgaagagcaattgattaataaaggtgttgcattctgccctcactgtgacgga
cctctatttgaaaataaagacgtagcagttatcggtggcggtaactctggggttgaagca
gcaattgaccttgctggtatcgttaatcatgttacattattcgaattcgctagcgaatta
aaagcagacaacgtgttacaagatcgtttacgttctttatcaaatgttgatatcaaaaca
aatgccaaaactactgaagttgtcggagaaaaccatgttacaggtatacgttacgaagac
atgagcaccggcgaagaacatctacttaacttagatggtatctttgttcaaattggttta
cttccaagcacatcatggttaaaagatgctgttgaattaaacgaacgtggtgaaattgtt
attgatcgtaacaataatactaacgtacctggaatatttgctgctggcgatgtcacagat
cagaagaacaaacaaattattatttcaatgggcgctggtgcaaatgcagcattaaatgcc
tttgactatattatcagaaactaa

DBGET integrated database retrieval system