KEGG   Shewanella baltica BA175: Sbal175_2333Help
Entry
Sbal175_2333      CDS       T02014                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00473  D-Alanine metabolism
sbb00550  Peptidoglycan biosynthesis
sbb01100  Metabolic pathways
sbb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sbal175_2333
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal175_2333
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Sbal175_2333
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbb01011]
    Sbal175_2333
Enzymes [BR:sbb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sbal175_2333
Peptidoglycan biosynthesis and degradation proteins [BR:sbb01011]
 Precursor biosynthesis
  Amino acid ligase
   Sbal175_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEG11586
UniProt: G0B0Q4
LinkDB All DBs
Position
2760164..2761177
Genome map
AA seq 337 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTTAGDDCEL
TNSREIRFRDESKTPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQAALAQWGSIFVKAASQGSSVGCYKVDDS
DKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYNGEVVATVPGEIICDTNTFYTFDEK
YAKNSKARTDVVAQHVSAEISEQIRAYSIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLTAKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatcaatctacttttgctgtgcggcggcggaagtgccgaacacgatatttca
ttaatgtcggccaactattttgaaacctcactggcaaaatctgagcagttttccgtgttg
cgagtcgagctagataaattcggccagtaccgcaccaccgcaggtgatgactgtgaactg
accaatagccgcgaaattcgctttcgtgatgaaagcaaaacgccatggccagtcgattac
gtcattccttgcattcatggctatcccggcgagaccggcgacattcaatcctattttaat
ctgatccaactgccctattttggctgtgaatccgaagcgagcagtaactgcttcaataag
atcaccgctaaaatgtggttctcggccttaggtattcctaatacgccgtatattttcctg
aatcagttcgatgatgcggcgattgagcaaacccaagccgcattggcacaatggggatcg
atcttcgttaaagcggcatcacagggttcctctgttggttgttacaaagtggatgacagc
gataaagttgcaggcgtgcttaaggatgcttttggctatgcaccctatgtgatcgttgaa
aaaaccattaaagcccgcgagttagaagtggcagtctacgagtacaatggagaagtggtg
gcgacagtgccaggtgaaatcatctgtgataccaacaccttctacaccttcgatgagaaa
tacgccaaaaacagtaaagcgcgcaccgatgtggtcgcgcagcatgtgtcagctgagatc
agtgaacaaatccgcgcctattcaatcaaggcatttaaaggaatgaagctgcgtcacctg
tcacgcatcgactttttcttaaccgcggacaatgaaattctattgaatgaaatcaatacc
tttcctggttctacgccgatttctatgttccctaaaatgctgcaaaatcacggtcatgac
tttactgaatacttgagcctagtgattaacggtcagctaaccgctaaatcttag

DBGET integrated database retrieval system