KEGG   Streptomyces bingchenggensis: SBI_05911Help
Entry
SBI_05911         CDS       T01678                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00250  Alanine, aspartate and glutamate metabolism
sbh00410  beta-Alanine metabolism
sbh00430  Taurine and hypotaurine metabolism
sbh00650  Butanoate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh02024  Quorum sensing
Module
sbh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SBI_05911
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBI_05911
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBI_05911
   00430 Taurine and hypotaurine metabolism
    SBI_05911
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SBI_05911
Enzymes [BR:sbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SBI_05911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADI09031
UniProt: D7CGC7
LinkDB All DBs
Position
complement(7188323..7189747)
Genome map
AA seq 474 aa AA seqDB search
MTLHTGRHGKRDEGRRRRGVAVNPFYGVADPVGGMADEVPRNRLPDGPMAPATACQLVHD
ELMLDVNARLNLATFVTTWMEPQGDQVLFQCRDKNLIDKDEYPRTAELERRCVAMLAHLW
HAPEPDSVMGCSTTGSSEACMLAGMAFKRRWAKRNPARYPGTARPNLVMGVNVQVCWEKF
CNFWEVEARQVPMEGDRFHLDPQAAADLCDENTIGVVTVLGSTFDGSYEPVAEVCAALDD
LQERTGLDIPVHVDGASGAMVAPFLDTDLVWDFRLPRVASINTSGHKYGLVYPGVGWVLW
RTTENLPKELVFRVNYLGGELPTFSLTFSRPGSQVAAQYYTFLRLGREGYRAVQQTTRDV
ARSLAERIEALGDFRLLTRGDELPVFAFTTAEGVRNFDVFDVSRRLREHNWLVPAYTFPP
NRQDLSVLRVVCRNGFSADLSDLFLEDLETLLPELRSQPHPLDRPENLATAFHH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacgctccacacgggcagacacggcaagcgggacgagggcaggcggcggcgcggtgtc
gccgtcaaccccttctacggggtggccgacccggtcggcggcatggccgacgaggtgccg
cgcaaccggctgcccgacggcccgatggcgcccgccaccgcctgtcagctcgtacacgac
gagctgatgctggacgtcaacgcccggctcaacctcgccaccttcgtcaccacctggatg
gagccgcagggcgaccaggtgctgttccagtgccgcgacaaaaacctgatcgacaaggac
gagtacccgcgcaccgccgagttggagcggcgctgcgtcgcgatgctggcccatctgtgg
cacgcccccgaaccggactcggtcatgggctgttccaccactggttcgagcgaggcgtgc
atgctcgccggaatggccttcaagcgccgctgggccaagcgcaacccggcacgctatccg
gggacggcccggcccaacctggtcatgggggtcaacgtccaggtctgctgggagaagttc
tgcaacttctgggaggtcgaggcgcgccaggtgcccatggagggcgaccggttccacctc
gacccccaggcggccgccgatctgtgcgacgagaacaccatcggcgtcgtcaccgtcctc
gggtccaccttcgacggctcgtacgaacccgtcgcggaggtttgcgcggcgctcgacgac
ctacaggagcgcaccggactggacatcccggtccatgtggacggtgcgtcgggcgcgatg
gtggcgcccttcctcgatacggacctggtgtgggacttccggctgccccgggtcgcctcc
atcaacacctcggggcacaagtacggcctggtctaccccggcgtgggatgggtgctgtgg
cgcaccaccgagaaccttcccaaggagcttgtcttccgcgtcaactatctgggcggcgaa
ttgccgaccttctcgctgaccttctcccggcccggctcccaggtggccgcccagtactac
acctttctgcggctggggcgggagggctaccgcgccgtgcagcagaccacccgggacgtg
gcgcgctcgctggccgagcggatcgaggcgctgggcgacttcaggctgctgacgcgcggg
gacgaactgccggtcttcgccttcaccacggccgagggcgtgcggaacttcgatgtgttc
gatgtgtcgcggcggctgcgcgaacacaactggctggtgcccgcctacaccttcccgccg
aaccggcaggacctgtccgtgctgcgggtggtgtgccgcaacggattctcggcggacctc
tccgacctcttcctggaggacctggagacgctgctgcccgaactgcggagccagccgcat
ccgctggaccggcccgagaacctggccacggccttccaccactga

DBGET integrated database retrieval system