KEGG   Streptomyces bingchenggensis: SBI_09196Help
Entry
SBI_09196         CDS       T01678                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
sbh  Streptomyces bingchenggensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ADI12314
UniProt: D7C3U8
LinkDB All DBs
Position
complement(10929576..10931243)
Genome map
AA seq 555 aa AA seqDB search
MSYGRLGRRSRAIGAWLQERGLAGSRALLLYPPGAEFICGYMGCLSAGVIAVPGVPAQGR
RQNHRALTRMKRLIADADVKVILGGRQVIESLAGMAEDFPQLADITCVITEEIPDEAENS
WQATEISPDSVAFLQYTSGSTSAPRGVAVTHGNLMDNQRVLTEGFGHSPDAIAECGGELF
VSWLPVYHDMGLIAPVLNTLYLGGTSTLFSPLHFLQRPERWLTAISRYRPHTSGAPNFAY
ELCLRHATPELMDRLDLEPWRVAFNGAEPVRAATLRRFSDTFATAGFRREAFLPCYGLAE
ATLMVSGSSVGAAPTLVSRSDIGSLGARPGTADAELVGCGRPGPGMTVLIVDAERLEECP
EGEVGEIWVAGESVARGYWRNTLATREVFRASLKDGRSGFLRTGDLGFLRNGELFITGRI
KDLMVIDGRNHYPQDLELSAEMCHPALRPGCTAAFSVEDGGLGEQPVVVAEAAPEAAPEF
DQITALIRSTIGEAHGLSVRDVVLVSPGTIPKTSSGKIQRRASRTAYLEGTLSVVGSAAN
SSVGAAVGSSNGSGG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgtacgggcggctgggccggcgttcccgggccatcggcgcctggcttcaggagcgc
ggtctcgccggttcccgtgcgctgctgctgtatccgcccggcgcggaattcatctgcggc
tatatggggtgtctctcggccggggtcatcgcggtgccgggcgtgccggcgcaggggcgc
aggcagaaccaccgggccctgaccaggatgaagcgcctgatcgccgacgcggatgtcaag
gtgatcctgggcggtcggcaggtcatcgaatccctggccggcatggcggaggactttccc
caactggccgacatcacctgcgtcatcaccgaggaaatacccgacgaggcggagaattcc
tggcaggcaacggagatcagtccggattcggtcgcgtttctccagtacacatccggctcg
acctcggctccgcgcggcgtggcggtgacgcatggcaatctgatggacaaccagcgggtc
ctcacggagggattcgggcacagccccgacgcgatcgccgagtgcggcggggagctcttc
gtcagctggctgccggtgtatcacgacatgggactcatcgcccccgtgctcaacaccctc
tacctgggcgggacgtccaccctcttctccccgctgcatttcctgcaacggcccgagcga
tggctgaccgccatttcgcggtaccgcccgcacaccagcggggcgcccaacttcgcctac
gagctgtgtctgcggcatgccacgcccgagctcatggaccgtctcgacctggagccgtgg
cgcgtggcgttcaacggcgccgagccggtgcgggccgcgacgctgcggcggttctccgac
accttcgccaccgccggcttccggcgtgaggcgttcctcccgtgctacgggctcgcggag
gcgacgctgatggtgagcggcagctcggtgggcgcggcgccgacgctggtcagcaggtcc
gacatcggttcgctcggtgcgcgccccgggacggccgacgcggaactggtcggctgcggc
cggccgggccccggtatgacggtgctgatcgtcgacgccgaacgccttgaggagtgcccc
gagggcgaggtcggcgagatctgggtcgccggtgagagcgtcgcccgcggctactggcgc
aacaccctcgcgacccgtgaggtgttccgggcgtcgctgaaggacggcaggagcggtttt
ctgcggacgggcgacctgggattcctgcggaacggggagctgttcatcaccggccggatc
aaggacctgatggtgatcgacgggcgcaaccactacccccaggacctggagctgtcggcc
gagatgtgccaccccgcgctgcggcccggctgcaccgccgcgttctccgtcgaggacggg
gggctgggcgagcagccggtcgtcgtcgcggaggcggcgccggaggccgcgcccgagttc
gaccagatcaccgccctgatccgcagcacgatcggcgaggcccatggcctgtcggtgcgg
gacgtcgtgctggtcagccccggcaccatccccaagacgtccagcggcaagatccagcgc
cgcgcctcccggacggcgtatctcgaggggacgctgtccgtcgtcggctcagcggccaac
tcgtcagtcggcgcagcggtcggttcctccaacggcagcggcggttag

DBGET integrated database retrieval system