KEGG   Shewanella bicestrii: CF168_09285Help
Entry
CF168_09285       CDS       T05197                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbj  Shewanella bicestrii
Pathway
sbj00473  D-Alanine metabolism
sbj00550  Peptidoglycan biosynthesis
sbj01100  Metabolic pathways
sbj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CF168_09285
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CF168_09285
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CF168_09285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbj01011]
    CF168_09285
Enzymes [BR:sbj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CF168_09285
Peptidoglycan biosynthesis and degradation proteins [BR:sbj01011]
 Precursor biosynthesis
  Amino acid ligase
   CF168_09285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ASK69050
UniProt: A0A220UM08
LinkDB All DBs
Position
complement(2116743..2117753)
Genome map
AA seq 336 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLLSANYFETSLAKSEQFNVLRVVLDKFGQYQTAAGDDCEL
TNNREIRFRDETKAPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQYDDEAIAQTQAALENWGSIFVKAASQGSSVGCYKVDDS
SKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYQGEVVATLPGEIICDSNTFYTFDEK
YAKSSKARTDVVAQNVPTDISEQIRAYAIKAFKGMKLRHLSRIDFFLTQDNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLAAK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatcaatttacttttgctgtgcggcggtggaagtgcggaacacgatatttcc
ctactgtcggctaattattttgaaacctcattagcaaaatccgagcagtttaatgtactg
cgtgtggtactggacaagtttggccaataccaaaccgccgcaggcgatgactgtgagctg
accaataaccgcgaaattcgcttccgtgatgagaccaaggcgccttggcctgtggattat
gtgatcccttgtattcacggctatccgggcgagacaggcgacattcagtcttacttcaat
cttatccaactgccctactttggttgcgagtccgaagccagcagcaactgttttaacaag
atcaccgctaagatgtggttcagtgctctaggcatccctaacacaccttatatcttctta
aatcaatacgatgatgaagcgattgcccaaacccaagccgcgctcgaaaactggggttcg
attttcgtcaaagccgcatctcaaggttcttctgtaggttgctataaagtcgatgacagc
agcaaagtcgctggcgtgttaaaagatgccttcggttatgcgccctatgtgattgtcgaa
aaaaccattaaggcccgtgagcttgaagtcgccgtttatgagtatcaaggcgaagtggtt
gcgactctgccgggcgaaatcatctgcgatagcaataccttctacaccttcgatgaaaaa
tacgccaagagcagtaaggcccgcaccgatgtggtcgcgcaaaacgtaccaactgacatc
agcgagcagatccgcgcctatgcaattaaagcctttaagggcatgaagcttcgccatctg
tcacgtatcgactttttcttaacccaagataatgaaatcctattgaatgaaatcaatacc
ttcccgggttcgacgccgatttcgatgttccctaaaatgttacaaaaccatgggcatgat
tttaccgaatacttaagtttggtgattaacggccagttagcggctaagtga

DBGET integrated database retrieval system