KEGG   Shewanella baltica OS155: Sbal_2283Help
Entry
Sbal_2283         CDS       T00478                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00473  D-Alanine metabolism
sbl00550  Peptidoglycan biosynthesis
sbl01100  Metabolic pathways
sbl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sbal_2283
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal_2283
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sbal_2283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbl01011]
    Sbal_2283
Enzymes [BR:sbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sbal_2283
Peptidoglycan biosynthesis and degradation proteins [BR:sbl01011]
 Precursor biosynthesis
  Amino acid ligase
   Sbal_2283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ABN61779
UniProt: A3D4W6
LinkDB All DBs
Position
2649984..2650997
Genome map
AA seq 337 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTAAGDDSEL
TNSREIRFRDESKTPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQAALAQWGSIFVKAASQGSSVGCYKVDDS
DKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYNGEVVATVPGEIICDTNTFYTFDEK
YAKNSKARTDVVAQHVSAEISEQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLTAKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatcaatctacttttgctgtgcggcggcggaagtgccgaacacgatatttca
ttaatgtcggccaactattttgaaacctcactggcaaaatctgagcagttttccgtgttg
cgagtcgagctggataaattcggccagtaccgcactgccgctggtgacgacagtgagctg
accaatagccgcgagattcgcttccgtgatgaaagcaaaacgccatggccagtcgattac
gtcattccttgcattcatggctatcccggcgagactggcgacattcaatcctattttaat
ctgatccaactgccctattttggctgtgaatccgaagcgagcagcaactgcttcaataag
atcaccgctaaaatgtggttctcggccttaggtattcctaatacgccatatattttcctg
aatcagttcgatgatgcggcgattgagcaaacccaagcggcattggcacaatggggatcg
atcttcgttaaagcggcctcgcagggttcctctgttggttgttacaaagtggatgacagc
gataaagttgcaggcgtgcttaaggatgcttttggctatgcaccctatgtgatcgttgaa
aaaaccataaaagcccgcgagttagaagtagcagtatacgagtacaatggtgaagtggtg
gcgacagtgccaggtgaaatcatctgtgataccaacaccttctacaccttcgatgagaaa
tacgccaaaaacagtaaagcgcgcaccgatgtggtcgcacagcatgtttcagctgagatc
agcgaacagatccgtgcctatgcaatcaaggcatttaaaggaatgaagctgcgtcatctg
tcgcgcatcgactttttcttaaccgcggacaatgaaattctattgaatgaaatcaatacc
ttcccaggttctacgccgatttctatgttccctaaaatgctgcaaaatcacggtcatgac
tttactgaatacttgagcctagtgattaacggtcagctaaccgctaaatcttaa

DBGET integrated database retrieval system