KEGG   Shewanella baltica OS223: Sbal223_2294Help
Entry
Sbal223_2294      CDS       T00803                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00473  D-Alanine metabolism
sbp00550  Peptidoglycan biosynthesis
sbp01100  Metabolic pathways
sbp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sbal223_2294
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal223_2294
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Sbal223_2294
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbp01011]
    Sbal223_2294
Enzymes [BR:sbp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sbal223_2294
Peptidoglycan biosynthesis and degradation proteins [BR:sbp01011]
 Precursor biosynthesis
  Amino acid ligase
   Sbal223_2294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ACK46793
UniProt: B8E569
LinkDB All DBs
Position
2730078..2731091
Genome map
AA seq 337 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTAAGDDCEL
TNSREIRFRDESKTPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQTALAQWGSIFVKAASQGSSVGCYKVDDS
AKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYNGEVVATVPGEIICDTNTFYTFDEK
YAKNSKARTDVVAQHVSAEISEQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLTAKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatcaatctgcttttgctgtgcggcggcggaagtgccgaacacgatatttca
ttaatgtcggccaactattttgaaacctcactggcaaaatctgagcagttttccgtgttg
cgagtcgagctggataaattcggccagtaccgcactgccgctggtgacgactgtgagctg
accaatagccgcgagattcgcttccgtgatgaaagcaaaacgccatggccagtcgattac
gtcattccttgcattcatggctatcccggcgagactggcgacattcaatcctattttaat
ctgatccaactgccctattttggctgtgaatccgaagcgagcagcaactgcttcaataag
atcaccgctaaaatgtggttctcggccttaggtattcctaatacgccgtatattttcctg
aatcagttcgatgatgcggcgattgagcaaacccaaacagcattggcacaatggggatcg
atcttcgtcaaagcagcctcacagggttcctctgtcggttgttacaaagtggatgacagc
gctaaagtcgcaggcgtgctcaaggatgcttttggctatgcaccctatgtgatcgttgaa
aaaaccattaaagcccgcgagttagaagtggcagtctacgagtacaacggtgaagtggtg
gcgacagtgccaggtgaaatcatctgtgataccaacaccttctacaccttcgatgagaaa
tacgccaaaaacagtaaagcgcgcaccgatgtggtcgcgcagcatgtgtcagcagagatc
agcgaacagatccgcgcctatgcaatcaaggcatttaaaggaatgaagctgcgtcactta
tcgcgcatcgactttttcttaaccgcggacaatgaaattctattgaatgaaatcaatacc
ttccctggttctacgccgatttctatgttccctaaaatgctgcaaaatcacggccatgac
tttactgaatacttgagcctagtgattaacggtcagctaaccgctaaatcttag

DBGET integrated database retrieval system