KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101030208
Entry
101030208         CDS       T04350                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04218  Cellular senescence
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101030208 (GADD45B)
   04064 NF-kappa B signaling pathway
    101030208 (GADD45B)
   04068 FoxO signaling pathway
    101030208 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101030208 (GADD45B)
   04210 Apoptosis
    101030208 (GADD45B)
   04115 p53 signaling pathway
    101030208 (GADD45B)
   04218 Cellular senescence
    101030208 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101030208 (GADD45B)
   05202 Transcriptional misregulation in cancer
    101030208 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101030208 (GADD45B)
   05212 Pancreatic cancer
    101030208 (GADD45B)
   05225 Hepatocellular carcinoma
    101030208 (GADD45B)
   05226 Gastric cancer
    101030208 (GADD45B)
   05214 Glioma
    101030208 (GADD45B)
   05216 Thyroid cancer
    101030208 (GADD45B)
   05220 Chronic myeloid leukemia
    101030208 (GADD45B)
   05217 Basal cell carcinoma
    101030208 (GADD45B)
   05218 Melanoma
    101030208 (GADD45B)
   05213 Endometrial cancer
    101030208 (GADD45B)
   05224 Breast cancer
    101030208 (GADD45B)
   05222 Small cell lung cancer
    101030208 (GADD45B)
   05223 Non-small cell lung cancer
    101030208 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101030208 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101030208 (GADD45B)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101030208 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101030208 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101030208
NCBI-ProteinID: XP_003928658
UniProt: A0A2K6THK1
LinkDB
Position
Unknown
AA seq 160 aa
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEGDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVATYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagctgctggtggctgctcagcgccaggaccgcctcacagtgggggtg
tacgagtcggccaagttgatgaatgtagacccggacagcgtggtcctgtgcctcttggcc
attgacgaggaggaggagggtgacatcgctctgcaaatccacttcacgctcatccagtcc
ttctgctgcgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcacag
ctcctgggcgagccggccgagacccagggcaccaccgaggcccgggacctgcactgcctc
ctggtcacgaaccctcacacggacgcctggaagagccacggcttggtggaggtagccacc
tactgcgaagagagccggggtaacaaccagtgggtcccctacatctcgctccaggaacgc
tga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039106
Entry
101039106         CDS       T04350                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04218  Cellular senescence
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101039106 (GADD45G)
   04064 NF-kappa B signaling pathway
    101039106 (GADD45G)
   04068 FoxO signaling pathway
    101039106 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101039106 (GADD45G)
   04210 Apoptosis
    101039106 (GADD45G)
   04115 p53 signaling pathway
    101039106 (GADD45G)
   04218 Cellular senescence
    101039106 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101039106 (GADD45G)
   05202 Transcriptional misregulation in cancer
    101039106 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101039106 (GADD45G)
   05212 Pancreatic cancer
    101039106 (GADD45G)
   05225 Hepatocellular carcinoma
    101039106 (GADD45G)
   05226 Gastric cancer
    101039106 (GADD45G)
   05214 Glioma
    101039106 (GADD45G)
   05216 Thyroid cancer
    101039106 (GADD45G)
   05220 Chronic myeloid leukemia
    101039106 (GADD45G)
   05217 Basal cell carcinoma
    101039106 (GADD45G)
   05218 Melanoma
    101039106 (GADD45G)
   05213 Endometrial cancer
    101039106 (GADD45G)
   05224 Breast cancer
    101039106 (GADD45G)
   05222 Small cell lung cancer
    101039106 (GADD45G)
   05223 Non-small cell lung cancer
    101039106 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101039106 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101039106 (GADD45G)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101039106 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101039106 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101039106
NCBI-ProteinID: XP_003938239
UniProt: A0A2K6TJH5
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEVRGQDSVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggactcagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcacgagttgctgctgtcggcgcagcgccagggctgcctcact
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgccgatgaggaggacgagggcgacatcgcgctgcagatccatttcacgctg
atccaggcgttctgctgcgagaacgacatcgacatcgtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggcgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaatgaggacgcctggaaggaccccgctttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccctgagtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047513
Entry
101047513         CDS       T04350                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04218  Cellular senescence
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101047513 (GADD45A)
   04064 NF-kappa B signaling pathway
    101047513 (GADD45A)
   04068 FoxO signaling pathway
    101047513 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101047513 (GADD45A)
   04210 Apoptosis
    101047513 (GADD45A)
   04115 p53 signaling pathway
    101047513 (GADD45A)
   04218 Cellular senescence
    101047513 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047513 (GADD45A)
   05202 Transcriptional misregulation in cancer
    101047513 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047513 (GADD45A)
   05212 Pancreatic cancer
    101047513 (GADD45A)
   05225 Hepatocellular carcinoma
    101047513 (GADD45A)
   05226 Gastric cancer
    101047513 (GADD45A)
   05214 Glioma
    101047513 (GADD45A)
   05216 Thyroid cancer
    101047513 (GADD45A)
   05220 Chronic myeloid leukemia
    101047513 (GADD45A)
   05217 Basal cell carcinoma
    101047513 (GADD45A)
   05218 Melanoma
    101047513 (GADD45A)
   05213 Endometrial cancer
    101047513 (GADD45A)
   05224 Breast cancer
    101047513 (GADD45A)
   05222 Small cell lung cancer
    101047513 (GADD45A)
   05223 Non-small cell lung cancer
    101047513 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101047513 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101047513 (GADD45A)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101047513 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101047513 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 101047513
NCBI-ProteinID: XP_003921486
UniProt: A0A2K6TM87
LinkDB
Position
Unknown
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggacaaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcgcacgatcactgtcggggtg
tacgaggcggccaagctgctcaacgtcgaccccgataatgtggtgctgtgcctgctggcg
gcggacgaggacgacgacagggatgtggctctgcagatccacttcactctgatccaggcg
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcttggagaccgacgcgggccccgcggccagcgagggcgccgagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatctcaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

DBGET integrated database retrieval system