KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039083
Entry
101039083         CDS       T04350                                 

Gene name
UBR4
Definition
(RefSeq) E3 ubiquitin-protein ligase UBR4 isoform X2
  KO
K10691  E3 ubiquitin-protein ligase UBR4 [EC:2.3.2.27]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05165  Human papillomavirus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101039083 (UBR4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101039083 (UBR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101039083 (UBR4)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101039083 (UBR4)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    101039083 (UBR4)
SSDB
Motif
Pfam: E3_UbLigase_R4 zf-UBR Ribosomal_L30 DUF4820
Other DBs
NCBI-GeneID: 101039083
NCBI-ProteinID: XP_003934995
UniProt: A0A2K6V6R8
LinkDB
Position
Unknown
AA seq 5182 aa
MATSGGEEAAAAAPAPGASATGADMTPGWEVAVRPLLSASYSAFEMKELPQLVASVIESE
SEILHHEKQYEPFYSSFVALSTHYITTVCSLIPRNQLQSVAAACKVLIEFSLLRLENPDE
ACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPV
SPELRQKEVQMNFLNQLTSVFNPRTVASQPISPQTLVEGENDEQSSTDQASAVKTKNVFI
AQNVASLQELGGSEKLLRVCLNLPYFLRYINRFQDAVLANSFFIMPATVADATAVRNGFH
SLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCLYAGVSVATCMAILHVGSAQQVRT
GSTSSKEDDYESDAATIVQKCLEIYDMIGQAISSSRRAGGEHYQNFQLLGAWCLLNSLFL
ILNLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSPKLGPGKGHQGFGVLSVILANHA
IKLLTSLFQDLQVEALHKGWETDGPPAALSIMAQSTSIQRIQRLIDSVPLMNLLLTLLST
SYRKACVLQRQRKGSMSSDASASTDSNTYYEDDFSSTEEDSSQDDDSEPILGQWFEETIS
PSKEKAAPPPPPPPPPLESSPRVKSPSKQTSGEKGNILASRKDPELFLGLASNILNFITS
SMLNSRNNFIRNYLSVSLSEHHMATLASIIKEVDKDGLKGSSDEEFAAALYHFNHSLVTS
DLQSPNLQNTLLQQLGVAPFSEGPWPLYIHPQSLSVLSRLLLIWQHKASAQGDPDVPECL
KVWDRFLSTMKQNALQGVVPNETEDLNVEHLQLLLLIFHNFTETGRRAILTLFVQIIQEL
SVNMDAQMRSVPLILARFLLIFDYLLHQYSKAPVYLFEQVQHNLLSPPFGWASGSQDSSS
RRVTTPLYHGFKEVEENWSKHFSSDAVPQPRFYCVLSPEASEDDLNRLDSVACDVLFSKL
VKYDELYAALTALLAAGSQLDTVRRKENKNVTALEACALQYYFLILWRILGILPPSKTYI
NQLSMNSPEMSECDILHTLRWSSRLRISSYVNWIKDHLIKQGMKAEHASSLLELASTAKC
SSVKYDVEIVEEYFARQISSFCSIDCTTILQLHEIPSLQSIYTLDAAISKVQVSLDEHFS
KMAAETDPHKSSEITKNLLPATLQLIDTYASFTRAYLLQNFNEEGTTEKPSKEKLQGFAA
VLAIGSSRCKANTLGPTLVQNLPSSVQAVCESWNNINTNEFPNIGSWRNAFANDTIPSES
YISAVQAAHLGTLCSQSLPLAASLKHTLLSLVRLTGDLIVWSDEMNPPQVIRTLLPLLLE
SSTESVAEISSNSLERILGPAESDEFLARVYEKLITGCYNILANHADPNSGLDESILEEC
LQYLEKQLESSQARKAMEEFFSDSGELVQIMMATANENLSAKFCNRVLKFFTKLFQLTEK
SPNPSLLHLCGSLAQLACVEPVRLQAWLTRMTTSPPKDSDQLDVIQENRQLLQLLTTYIV
RENSQVGEGVCAVLLGTLTPMATEMLANGDGTGFPELMVVMATLASAGQGAGHLQLHNAA
VDWLSRCKKYLSQKNVVEKLNANVMHGKHVTILECTCHIMSYLADVTNALSQSNGQGPSH
LSVDGEERAIEVDSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCH
TCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTM
KESAFQSEPRISESLVRHASTSPADKAKVTISDGKVADEEKPKKSSLCRTVEGCREELQN
QANFSFAPLVLDMLNFLMDAIQTNFQQASAVGSSSRAQQALSELHTVEKAVEMTDQLMVP
TLGSQEGAFENVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGKI
TVLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFG
SSGSVSDHLVLHPQLATGNFIIKAVWLPGSQTELAIVTADFVKIYDLSVDALSPTFYFLL
PSSKIRDVTFLFNEEGKNIIVIMSSAGYIYTQLMEEASSAQQGPFYVTNVLEINHEDLKD
SNSQVAGGGVSVYYSHVLQMLFFSYCQGKSFAATISRTTLEVLQLFPINIKSSNGGSKTS
PALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIKTLPAKAKIQDMVAIRHTA
CNEQQRTTMILLCEDGSLRIYMASVESTSYWLQPSLQPSSVISIMKPVRKRKTATITTRT
SSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEIS
NNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADKKL
NLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEEFPSASVSNICPSNLNQSNGTGD
SDSAAPTTTSGTVLERLVVSSLEALESCFAVGPIIEKERNKNAAQELATLLLSLPAPASV
QQQSKSLLASLHTSRSAYHSHKDQALLSKAVQCLNTSSKEGKDLDPEVFQRLVITARSIA
IMRPNNLVHFTESKLPQTETEGMDEGKEPQKQLEGDCCSFITQLVNHFWKLHASKPKNAF
LAPACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCPDPAVSFSCKQAL
IRVLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSGIPNGGHIRQESQEQSE
VDHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPMLDIPPDADDETMVELAIA
LSLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTASAPASDDEGSTAATDGST
LRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEGHPAGPGSVSSSTGAIS
TTTGHQEGDGSEGEGEGEAEGDVHTSNRLHMVRLMLLERLLQTLPQLRNVGGVRAIPYMQ
VILMLTTDLDGEDEKDKGALDNLLSQLIAELGMDKKDVSKKNERSALNEVHLVVMRLLSV
FMSRTKSGSKSSICESSSLISSATAAALLSSGAVDYCLHVLKSLLEYWKSQQNDEEPVAT
SQLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKIADTNSRI
PPPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIK
KLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVL
YFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAALAASAGSSSASSSSAPVAASSGQATT
QSKSSTKKSKKEEKEKEKDGESSGSQEDQLCTALVNQLNKFADKETLIQFLRCFLLESNS
SSVRWQAHCLTLHIYRNSSKSQQELLLDLMWAIWPELPAYGRKAAQFVDLLGYFSLKTPQ
TEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPEVP
FCYIKLSSIKVDTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQA
IVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCP
RCSASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCC
AVDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLLCKVNEAAPEKPQDDSGT
AGGISSTSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATK
SSRTSVQPTFTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILV
SQGLIRELFDYNLRRGAATMREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWAN
PDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFLMAVNIKTPVVVENITLMCLRILQ
KLIKPPAPTSKKNKDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYDAWKKCLPIRGID
GNGKAPSKSELRHLYLTEKYVWRWKQFLSRRGKRTSPLDLKLGHNNWLRQVLFTPATQAA
RQAACTIVEALATIPSRKQQVLDLLTSYLDELSIAGECAAEYLALYQKLITSAHWKVYLA
ARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTGLLSSFVEVESIKRHFKSR
LVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYN
LDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGP
LMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWCTTNEGEPMRIV
YRMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLAGIRDFKQG
RHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESKDSGGAAVAEQ
VLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP
YLSFGEVEKMQILVERFKPYCNFDKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDL
ILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAIQHPATQVLIG
TDSIPNLHKLEQVSSDEGIGTLAENLLEALREHPDVNKKIDAARRETRAEKKRMAMAMRQ
KALGTLGMTTNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYTFTKR
VALEEMENKPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLP
VWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGG
GRESNIHLIPYIIHTVLYVLNTTRATSREEKNLQGFLEQPKEKWVESAFEVDGPHYFTVL
ALHILPPEQWTATRVEILRRLLVTSQVRAVAPGGATRLTDKAVKDYSAYRSSLLFWALVD
LIYNMFKKVPTSNTEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDV
AGLLSEITDPESFLKDLLNSVP
NT seq 15549 nt   +upstreamnt  +downstreamnt
atggcgacgagcggcggcgaagaggcggcggcagcggcgccggcccccggggcctcggca
acgggggcggacatgaccccgggctgggaggtggcggtgcggcccctgttgtccgcatcc
tactccgccttcgagatgaaggagttgccacagctggtggcctcagtcatcgagagcgaa
tcagaaatcctgcaccatgagaagcagtacgagccattctactcatcttttgttgcactt
tccacacactatatcacaacagtttgcagtctcattccccggaaccaacttcagtcagtg
gcagcagcctgtaaagttctaattgagttttctctcctgcgtttggagaatccagatgag
gcttgtgctgtgtcccagaaacacttgattctcctaatcaagggcctgtgcactggctgt
agccgactagatagaactgaaattatcacgtttacagcaatgatgaaatctgccaagctg
ccccaaacagtgaagacactttcagatgtggaagatcagaaagagctggcctcaccagta
agtcctgagttgaggcaaaaggaggtacagatgaattttttgaaccagctgacctcagtt
tttaaccctagaacggtagcatcgcaacctatcagtccacagactctggtggaaggagaa
aatgacgagcagtcatccacagatcaagcctcagctgtcaaaaccaagaatgtgttcata
gctcagaatgtggctagtcttcaagagcttggtggctcagagaagctactgcgtgtatgt
ttgaacctgccatattttctgcgctatatcaatcggttccaagatgcagtgttagctaat
tccttcttcataatgcctgcaacagtagcagatgccactgctgttcgtaatggctttcat
tcactggtgattgatgtaactatggcattggataccctttctctacctgtgttggaacct
ctcaatccttctcgtctacaagatgtgacagtcctcagcctaagttgtctgtatgcaggt
gtgagtgtggcgacctgcatggccatcctgcatgtgggtagtgcccaacaagtgcggaca
gggtccacgagctccaaagaagacgactatgaaagtgacgcagctacaattgtccagaaa
tgtcttgaaatctatgacatgattggacaagcaatcagcagttctcgccgggctggtggg
gagcactatcagaatttccagttgctaggtgcatggtgcttattgaacagccttttcctc
atactgaacctcagtcctactgcgttggctgataaggggaaagagaaagacccgctggct
gccctccgagtcagagacatcctttctcgtactaaagagggagtgggctctcctaaactg
gggcctggaaaagggcatcagggatttggggtactctcagtaatattggcaaatcatgcc
atcaaactgctaacgtctctctttcaagacctacaagtggaggcccttcacaagggttgg
gagacagatggacctcctgcagccctgagcattatggctcagagcacctccatacagagg
attcagcggctgattgactctgtcccactgatgaacctactcttgacgttactttcaact
tcctacagaaaggcatgcgttctgcagcggcagaggaagggctccatgagcagcgatgcc
agtgcctctactgactccaatacttactatgaggatgatttcagtagcacggaggaggac
agcagccaagacgacgacagtgaacctattttggggcaatggtttgaggagactatttct
cccagtaaagagaaagcagcacctccgccccctcctccgcctcctccactggaaagctct
cctcgggttaaaagccctagtaagcagacctctggtgagaagggaaacattttggcaagt
cgcaaagatcctgagttgttcttaggtctggcttcaaacattttgaacttcatcacctct
tccatgttgaactctcggaacaattttatccgaaactatctgagtgtatctctttcggaa
caccatatggccaccctagccagtatcatcaaggaggtggacaaagatggactcaagggt
tcatcagatgaagagtttgctgcggctctctatcacttcaaccactctctggtaacctct
gaccttcagtcacctaacctgcagaacactctgttgcagcagctgggagtggctcctttt
tctgagggcccttggcccttgtacattcaccctcaaagcctctctgtgctttcacgcctc
ctgctcatctggcaacataaagccagtgctcaaggtgaccctgacgtccctgaatgcctt
aaagtttgggacaggtttttgtctacaatgaaacagaatgccctgcaaggtgtggtaccc
aatgagacagaagatttgaatgtggaacacctgcagctgctgctcctcattttccacaac
ttcactgagacaggccggcgggccatactgacgctttttgtccagatcatccaggagttg
agcgttaacatggatgctcagatgcgctctgtgccactcatcttggctcgcttccttctc
atctttgattatctgcttcatcagtattccaaagcccctgtgtatctttttgagcaggta
cagcataacctgctaagtcctccttttgggtgggcaagtggatcccaggacagcagcagc
cgccgggtgaccactcctctctatcatgggttcaaagaagtagaggaaaactggtctaag
catttctcatcagatgctgtcccacaacccagattctactgtgtcctgtccccagaagcc
tcagaggatgatttgaaccgacttgattctgtggcatgtgatgtccttttctccaagctt
gtcaagtatgatgagctttatgctgcactgacagccctgcttgcagctgggtcccagctt
gatacagtgaggagaaaggaaaacaagaatgtaacagccttggaggcctgtgcccttcag
tattactttttgatattgtggaggatcctaggaattttgccaccatcaaagacttacatt
aaccagctatccatgaactcacctgagatgagtgaatgtgacatcttgcacactctgcga
tggtcttctcggctccggatcagctcctatgtcaactggataaaggatcaccttatcaaa
cagggaatgaaggctgagcatgctagctcactcctagagctggcatccactgccaagtgt
agctcagtgaaatacgatgttgaaatagtggaggaatacttcgctcgacagatctcatcc
ttctgtagtatcgactgtaccaccatcttgcagctgcatgaaattccaagtctacagtcc
atctacacccttgatgctgccatctcaaaagtccaggtctctttggatgagcatttttct
aagatggctgctgagaccgatcctcataagtcgtctgaaattaccaagaacctacttcca
gccacgctacagcttattgacacctatgcatcattcaccagagcctatttgctgcagaac
tttaatgaagagggaacaactgagaaaccttcgaaggagaaactgcaaggctttgctgct
gttttggctattggctctagtaggtgcaaggcaaatactctgggtccgacactggttcag
aatttgccatcgtcagtgcaggctgtgtgtgagtcctggaacaacatcaataccaatgaa
tttcccaatattgggtcctggcgcaatgcctttgccaatgacaccatcccttcagagagt
tatatcagtgcagtgcaggctgcacacttggggactctctgtagccaaagtctgccactg
gctgcttccctgaagcataccctcctctccctggtcaggttgactggagatcttattgtt
tggtcagatgagatgaacccaccacaggtaattcggaccctgctacctcttcttttggaa
tcaagcactgagagtgttgctgagatcagtagcaactccctggaacgcatcttgggccct
gctgagtctgatgagttcttggcgcgtgtttatgagaagttgatcactggttgttacaac
attctggccaatcatgcggatcctaacagtggactggatgaatccatcctggaggaatgt
cttcagtacttggaaaagcagctggaaagcagccaggctcgtaaagctatggaggagttt
ttctctgacagtggagaacttgtacagatcatgatggcaacagccaatgagaacctctct
gcaaaattctgtaaccgagttttgaaattcttcaccaaactcttccagctgactgagaag
agccctaacccgagcctgttgcatctctgcggctccctggcacagctggcctgcgtggag
cctgtgcgcctgcaggcctggctcacccgcatgactacatcacccccaaaagattctgat
cagctggatgtaattcaggagaatcggcagctgctgcagttactgactacatacattgtt
cgggaaaacagccaagttggggaaggcgtgtgtgctgttcttctgggcaccctgaccccc
atggcaacagagatgctggccaatggtgatgggactggcttccctgaactcatggttgtg
atggccaccctggccagtgcaggtcaaggtgctggtcaccttcagcttcataatgctgct
gtggattggctgagcagatgtaagaaatacctgtcacagaagaatgtggttgaaaaactg
aatgccaatgtaatgcatggaaagcatgtgacaatcttggagtgcacgtgccatatcatg
tcttacttggctgatgtcacgaatgccctgagccagagtaatggtcaaggcccaagtcat
ctctcagtggatggggaagagcgggccattgaagtagactcagactgggtggaggagttg
gccgtggaagaggaagattcccaggctgaggattcagatgaagattctctttgcaataaa
ctctgcacttttacgattacacagaaagaattcatgaaccagcattggtaccactgtcac
acctgcaaaatggtggatggggtgggtgtctgcacagtgtgtgctaaggtgtgccacaaa
gatcatgagatttcctatgccaagtatggatccttcttctgtgactgtggagccaaagaa
gatggcagctgtttggcactggtgaagagaactcctagcagcggcatgagctctaccatg
aaggagtcagcatttcagagtgaacccaggatttcagagagtctagtgcgccatgcgagc
acctcaccagctgacaaagccaaggttaccatcagtgatggaaaggttgctgacgaagag
aagcccaagaagagcagtctatgccgcacagtggagggctgccgggaggagttacagaac
caggccaatttctccttcgctcctctcgtgttagacatgctcaatttccttatggatgcc
attcagaccaacttccagcaagcttcagccgtcgggagcagcagccgcgctcagcaagcc
ctcagtgagctccacacagtagagaaggcagtggagatgacagaccagctgatggttccc
accttaggctcccaggaaggtgcttttgagaatgtgcggatgaattacagtggagaccag
ggccagaccatccggcagctgatcagcgctcatgtgctcaggcgggtggctatgtgtgtg
ctctcctctccccatgggcggcgccaacatttggctgtcagccatgagaagggcaagatc
actgttctgcagctttctgcactccttaagcaagcagattccagcaaaaggaagttgact
ctgacccgcttggcttctgccccagttcctttcactgtgttgagcctcaccggaaatccc
tgcaaggaagactacctggcggtttgtgggctaaaggactgccatgtgctcacctttggt
agctcaggctctgtttcggatcacttggttttgcaccctcagttggcaacggggaacttc
atcatcaaagctgtgtggttgcctggttcacagactgaattagcaattgtcactgcggac
tttgttaagatatatgacctgtctgttgatgccttgagtccaaccttctactttctcctg
ccaagctccaagataagagacgttactttccttttcaacgaggagggaaagaacatcatt
gttataatgtcttcggctgggtacatttatactcagctcatggaagaggccagcagtgcc
cagcagggacccttctatgtcacgaatgtgctggaaatcaatcatgaggacctgaaggac
agtaacagccaggtggcaggtggtggtgtgtccgtgtactactcccacgtgttgcagatg
ttgttcttcagctactgtcaaggcaaatcatttgcagccaccatcagcaggacaaccctg
gaggtgttgcaactcttccccatcaacatcaaaagttccaatggtggcagtaagacttct
cctgctctttgccagtggtctgaggtgatgaaccaccctggcttggtgtgctgtgtccag
caaactacaggggtgccgctggtagtcatggtgaaaccagacacttttcttatccaggag
attaagactcttcctgctaaagcaaagatccaagacatggttgccattaggcatacggcc
tgcaatgagcagcagcggacaacaatgattctgctgtgtgaggacggcagcctgcgcatt
tacatggccagcgtggagagcacctcctactggctgcagccgtccctgcagcccagcagt
gtcatcagcatcatgaagcccgttcgaaagcgcaaaacagctaccatcacaacccgcacg
tctagccaggtgactttccccattgacttttttgaacacaaccaacagctgacagatgtg
gagtttggtggtaatgacctcctccaggtctacaatgcacaacagataaaacaccggctg
aattccactggcatgtatgtggccaacaccaagcctggaggcttcaccattgagattagt
aacaacaatagcactatggtgatgacaggcatgcgcatccagattgggactcaagcaata
gaacgggccccatcatatatagagatcttcggcagaactatgcagctcaacctgagtcgc
tcacggtggtttgacttcccctttaccagagaagaagccctgcaggctgataagaagctg
aacctcttcattggggcctcggtggatccagcaggtgtcaccatgatagacgctgtaaaa
atttatggcaagactaaggaacagtttggctggcctgatgagcccccagaagaattccct
tctgcctctgtcagtaacatctgcccttcaaacctgaaccagagcaatggcactggagat
agcgactcagctgcgcccactacgaccagtggaactgtcctggagaggctggttgtgagt
tctttagaagccctggaaagctgctttgctgttggcccaatcatcgagaaggagagaaac
aagaatgccgctcaggagctggccactttgctgttgtccctgccggcacctgccagcgtc
cagcagcaatccaagagccttctggctagcctgcacaccagccgctcggcctaccacagc
cacaaggatcaggccttgctgagcaaagctgtgcagtgtctcaacacatccagtaaagaa
gggaaggatctggaccccgaggtgttccagaggctagtgatcacagctcgctccattgcc
atcatgcgccccaacaaccttgtccactttacggagtcaaagctgccccagacggaaaca
gaaggaatggatgaggggaaagaaccgcagaagcagctggaaggagattgctgtagtttc
atcacccagcttgtgaaccacttctggaaactccatgcatccaaaccgaagaatgccttc
ttggcacctgcctgccttccaggcctaactcatattgaagcaactgtcaatgctctggtg
gacatcatccatggctactgtacctgtgagctggattgtatcaacacagcatccaagatc
tacatgcagatgctcttgtgccctgatcctgctgtgagcttctcttgtaaacaagctctc
attcgagtcctaaggcccaggaacaaacggagacatgtgactttaccctcttcccctcga
agcaacactccaatgggagacaaggatgatgatgacgatgatgatgcagatgagaaaatg
cagtcatcagggatcccgaatggtggtcacatccgtcaggaaagccaggaacagagtgag
gtggaccatggagattttgagatggtgtctgagtcgatggtcctggagacagctgaaaat
gtcaacaatggcaacccctctcccctggaggccctgctggcaggcgcagagggcttcccc
ccaatgctggacatcccgcctgatgcagatgacgagaccatggttgaactagccattgcc
ctgagcctgcagcaggaccaacaaggcagcagcagcagtgccctgggcctgcagagcctg
ggactgtccggccaggcacccagctcttcctctctggacgcaggaaccctctctgacacc
acagcatcagctccagcctcagacgacgagggcagcacagcagcgacagatggttctacc
cttcggacctcccctgctgaccatggtggtagtgtgggctcggagagcgggggcagtgca
gtggactcagtggctggcgagcacagtgtgtctggccggagcagtgcttatggtgatgct
acagctgaggggcatccggctggaccaggaagtgtcagctcaagcactggagccatcagc
accaccactgggcaccaggagggagatggctccgagggagaaggagaaggggaagctgaa
ggagatgtccacactagcaacaggctgcacatggtccgtctaatgctattggagagatta
ctgcagaccctgcctcagttacgaaacgttggcggtgtccgggccatcccgtacatgcag
gtcattctaatgctcactacagatctggatggcgaagatgagaaagacaagggggcccta
gacaacctgctctcccagcttattgctgagttgggcatggataaaaaggatgtctccaag
aagaatgagcgcagcgccctgaatgaagtccatctggttgtaatgagactcctgagtgtc
ttcatgtcccgcaccaaatctggatccaagtcttccatatgtgagtcatcttctctcatc
tccagtgccacagcagcagctctcctgagctctggggctgtggactactgcctgcacgtg
ctgaaatcactgctggaatattggaagagccaacagaatgatgaggagcctgtggctacc
agccagttgctgaaaccacatactacctcctccccacctgacatgagcccattctttctc
cgccagtacgtgaagggtcatgctgctgatgtgtttgaggcctatactcagcttctaaca
gaaatggtactgaggcttccctaccaaatcaaaaagatcgctgacaccaattctcgaatc
cctcctcctgtctttgaccattcatggttttacttcctctccgagtacctaatgatccag
cagactccatttgtgcggcgtcaagtccgaaaacttctgctcttcatctgtggatccaaa
gagaagtaccgccagctccgggatttgcacaccctggactctcatgtgcgtgggatcaag
aagctgctagaagagcaggggatattcctccgggcaagtgtggttacagccagctcaggc
tccgccttgcaatatgacacactcatcagcctgatggagcacctgaaagcctgtgcagag
attgccgcccagcgaaccatcaactggcagaaattctgcattaaagatgactccgtcctg
tacttcctcctccaagtcagtttccttgtggacgagggcgtgtctccagtgctgctgcag
ctgctctcctgtgctctgtgcggtagcaaagtgctcgctgcactggcagcctctgcggga
tcctccagtgcttcttcctcctcagcccctgtggctgccagttctggacaagccacaaca
cagtccaagtcttccactaaaaagagcaagaaagaagaaaaagaaaaggagaaagacggt
gaaagctctggcagccaggaggaccagctgtgcacagctctggtgaaccagctgaacaaa
tttgctgataaggaaaccctgatccagttcctgcgttgcttcctgctagagtccaattct
tcctcagtgcgctggcaggcccactgcctgacgctgcacatctacagaaattccagcaaa
tctcaacaggagctcctgctagatctgatgtgggccatctggccagagctcccagcctat
ggtcgtaaggctgcccagtttgtggacctgctaggctatttctccttgaaaacaccacaa
acggagaaaaagttgaaggagtattcacagaaggctgtggagattctgcggactcaaaac
catattcttacaaaccaccccaactccaacatttataacactttgtctggcttagtggag
tttgatggctattacctggagagtgatccctgcctggtgtgtaataatccagaagtaccg
ttctgttatatcaagctctcttccattaaagtggacacgcggtacaccaccacccagcag
gttgtgaagctaattggcagtcacaccatcagcaaagtgacagtgaaaatcggggatctg
aaacgaaccaagatggtgcggaccatcaacctgtattataacaaccgaaccgtgcaggcc
atcgtggagttgaaaaacaagccagcacgctggcacaaagccaagaaagttcagctgacc
cctgggcagacagaggtgaagattgaccttccgttgcccattgtggcctccaacctgatg
attgagtttgcagacttctacgaaaactaccaggcctccacagagaccctgcagtgccca
cgctgtagtgcctcagtccctgccaacccaggagtctgtggcaactgtggggagaatgta
taccagtgtcacaaatgcagatccatcaactatgatgaaaaggatcccttcctctgcaat
gcctgtggcttctgtaaatatgcccgcttcgacttcatgctctatgccaagccttgctgt
gcagtggatcccattgaaaatgaagaagatcggaagaaggctgtatccaacatcaataca
cttttggacaaagccgatcgagtgtatcatcagctgatgggacacaggccacagctggag
aacctgctctgcaaagtgaatgaggcagctccagaaaagccacaggatgactcaggaaca
gcagggggcatcagctctacttctgccagcgtgaatcgttatatcctgcagttggctcag
gagtactgtggagactgcaagaactcttttgatgaactctccaaaatcatccagaaagtc
tttgcttcgcgtaaagagttgttggaatacgacctacagcagagggaagcagccactaaa
tcatcgcggacctccgtgcagcccacgttcactgccagccagtaccgtgccttatctgtc
ctgggctgtggccacacatcctccaccaagtgctacggctgcgcctcggctgttacagaa
cattgtatcacactacttcgggccctggccaccaacccagccttgaggcacattcttgtc
tcccagggccttatacgggagctcttcgattataatcttcgccgaggggctgcgaccatg
cgggaggaggtccgccagctcatgtgcctcctaactcgagacaacccagaagccacccag
cagatgaatgacctgattattggcaaggtctccacagccctgaagggccactgggccaac
cctgatctggcaagtagcctgcagtatgaaatgctgctgctgacggattctatctccaag
gaggacagctgctgggagcttcggttacgctgtgcgctcagccttttcctcatggctgtg
aacattaagactcccgtggtggttgagaacattaccctcatgtgcctgcggatcttgcag
aagctgattaaaccacctgctcccactagcaagaagaacaaggatgtccccgtcgaggcc
ctcaccacggtgaaaccatactgcaatgagatccatgcccaggctcaactgtggctcaag
agagaccccaaggcatcttacgatgcctggaagaagtgtcttcctatcagagggatagat
ggcaatgggaaagcccccagcaaatcagagctccgccatctctatttgactgagaagtat
gtgtggaggtggaaacagttcctgagtcgtcgggggaagcggacctcccccttggatctc
aaactgggacataacaactggctgcgccaagtgcttttcactccagcaacgcaggctgca
cgccaggcagcatgtaccattgtggaagctctagccaccattcccagccgcaagcagcag
gtcctggatctgcttaccagttacctggacgagctgagcatagctggggagtgtgcagcc
gagtacctggctctctaccagaagctcatcacttctgcgcactggaaagtctacttggca
gctcggggagtcctaccctatgtgggcaacctcatcactaaggaaatagcccgtctgctg
gccctggaggaggctaccctgagcaccgatctgcagcagggctatgcccttaaaagtctc
acaggccttctctcctcctttgttgaggtggaatccatcaaaagacattttaaaagtcgc
ttggtgggtaccgtgctgaatggatatctgtgcttgcgaaaactggtggtgcagaggacc
aagctgattgatgagacacaggatatgctgctggagatgctggaggacatgaccacaggt
acagaatcagaaaccaaggccttcatggctgtgtgcattgagacagccaagcgctacaac
ctggatgactaccggaccccggtgttcatcttcgagagactctgcagcatcatatatcct
gaggagaatgaagtcactgagttctttgtgaccctggagaaggatccccaacaagaagac
ttcttacagggcaggatgcccgggaacccgtatagcagcaatgagccaggcattgggcca
ctgatgagggatataaagaacaagatttgccaggactgtgatttggtggccctcctggaa
gatgacagtggcatggagcttctagtgaacaataaaatcattagtttggaccttcctgtg
gctgaagtttacaaaaaagtctggtgtaccacgaatgagggagagcccatgaggattgtt
taccgtatgcgggggctgctgggcgatgctacagaggagttcattgagtccctggactct
accacagatgaagaagaagatgaagaagaagtatacaaaatggctggtgtgatggctcag
tgtgggggcctggaatgcatgcttaacagactcgccgggatcagagatttcaagcaggga
cgccaccttctaacggtgctactgaaattgttcagttactgcgtgaaggtgaaagtcaac
cggcagcaactggtcaaactggaaatgaacaccttgaatgtcatgctggggactctaaac
ttggcccttgtagctgaacaagaaagcaaggacagtgggggcgcagctgtggctgagcag
gtgcttagcatcatggagatcattcttgatgagtccaatgctgagcccctgagtgaggac
aagggcaacctcctcctgacaggtgacaaggatcaactcgtgatgctcttggaccagatc
aacagcaccttcgtccgctccaaccccagcgtgctccagggcctacttcgcatcatcccg
tacctttcctttggagaggtggagaaaatgcagatcttggtggagcgattcaaaccatac
tgcaactttgataagtatgatgaagatcacagtggcgatgataaagtcttcctggactgc
ttctgtaaaatagctgctggcatcaagaacaacagcaatgggcaccagctgaaggatctg
attctccagaaggggatcacccagaatgcgcttgactacatgaaaaagcacatccctagc
gccaagaacttggatgccgacatctggaaaaagtttttgtctcgcccagccttgccgttt
atcctgaggctgcttcggggcctggccatccagcaccctgccacccaggttctgattgga
actgactccatcccaaacctgcataagctggagcaggtgtccagtgatgagggcattggg
accctggcagagaacctgctggaagccctgcgggaacaccctgatgtaaacaagaagatt
gacgcggcccgcagggagacccgggcggagaagaagcgcatggccatggcaatgaggcag
aaggctctgggcaccctgggcatgacgacaaatgaaaagggccaggtcgtaaccaagacg
gcactcctgaagcagatggaagagctgatcgaggaacccggcctcacgtgctgcatctgc
agggagggatacaagttccagcccacgaaggtcctgggcatttataccttcacgaagcgg
gtagccttggaggagatggagaataagccccggaaacagcagggctacagcaccgtgtcc
cacttcaacatcgtgcactacgactgccacctggctgccgtcaggttggctcgaggccgg
gaagagtgggaaagtgccgcccttcagaatgccaacaccaagtgcaatgggctccttccg
gtctgggggcctcacgtccccgaatcagcttttgccacttgcttggcaagacacaacact
tacctccaggaatgtacaggccagcgggagcccacgtaccagctcaacatccatgacatc
aaactgctcttcctgcggttcgccatggagcagtcgttcagcgcagacaccggcgggggc
ggccgagagagcaacatccacctgatcccctacatcattcacactgtgctttatgtcctg
aacacaacccgagcaacttcccgagaagagaagaacctccaaggctttctggagcagccc
aaggagaagtgggtggagagtgccttcgaagtggacgggccccactatttcacagtccta
gcccttcacatcctgccccctgagcagtggacagccacacgtgtggaaatcttgcggagg
ctgctggtgacctcgcaggtccgggcagtggctccaggtggagctaccaggctgacagat
aaggcagtgaaggactattctgcctaccgttcttcccttctcttttgggccctcgtcgat
ctaatttataacatgtttaagaaggtgcctaccagtaacacggagggaggctggtcctgc
tctctcgctgagtacatccgccacaatgacatgcctatctacgaagctgccgacaaagcc
ctgaaaaccttccaggaggagttcatgccggtggaaaccttctcagagttcctcgacgtg
gctggtcttctatcagaaatcaccgatcccgagagcttcctgaaggacctgttgaactca
gtcccctga

DBGET integrated database retrieval system