KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039658
Entry
101039658         CDS       T04350                                 

Gene name
APOC3
Definition
(RefSeq) apolipoprotein C-III
  KO
K08759  apolipoprotein C-III
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03320  PPAR signaling pathway
sbq04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101039658 (APOC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    101039658 (APOC3)
SSDB
Motif
Pfam: Apo-CIII ApoA-II ApoC-I DNA_pol_lambd_f
Other DBs
NCBI-GeneID: 101039658
NCBI-ProteinID: XP_003923717
UniProt: A0A2K6U3D9
LinkDB
Position
Unknown
AA seq 98 aa
MQPRVLLVVAFLALLASARASEAEDTSLLSFMQDYMQHATETAKDALTKVQESQVAQQAR
DWVTDGFSSLKDYWSTIKGKFSGFWDSNPEITIPAEGV
NT seq 297 nt   +upstreamnt  +downstreamnt
atgcagccccgggtactccttgttgttgccttcctggcactcctggcctctgcccgagct
tcggaggccgaggacacctcccttctcagcttcatgcaggactacatgcagcacgccacc
gagaccgccaaagacgcgctgaccaaagtgcaggagtcccaggtggcccagcaggccagg
gactgggtgaccgatggcttcagctccctgaaagactactggagcacgattaagggcaag
ttctctgggttctgggattcaaaccctgagatcacaattccggccgagggtgtctga

DBGET integrated database retrieval system