KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044364
Entry
101044364         CDS       T04350                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101044364 (PMAIP1)
   04215 Apoptosis - multiple species
    101044364 (PMAIP1)
   04115 p53 signaling pathway
    101044364 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044364 (PMAIP1)
   05203 Viral carcinogenesis
    101044364 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101044364 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101044364 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 101044364
NCBI-ProteinID: XP_003926076
UniProt: A0A2K6S6C4
LinkDB
Position
Unknown
AA seq 54 aa
MPGKKARKSAQPSPARAPADLEVECAIQLRRFGDKLNFRQKLLNLISKLFCSGT
NT seq 165 nt   +upstreamnt  +downstreamnt
atgcctgggaagaaggcgcgcaagagcgcgcaaccgagccccgcgcgggctccagcagac
cttgaagtcgagtgtgccattcaactcaggagatttggagacaaactgaatttccggcag
aaacttctgaatctgatatccaaactcttctgctcaggaacctga

DBGET integrated database retrieval system