KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044689
Entry
101044689         CDS       T04350                                 

Gene name
HIF1A
Definition
(RefSeq) hypoxia-inducible factor 1-alpha isoform X2
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq04137  Mitophagy - animal
sbq04140  Autophagy - animal
sbq04659  Th17 cell differentiation
sbq04919  Thyroid hormone signaling pathway
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05211  Renal cell carcinoma
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101044689 (HIF1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101044689 (HIF1A)
   04137 Mitophagy - animal
    101044689 (HIF1A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101044689 (HIF1A)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101044689 (HIF1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044689 (HIF1A)
   05205 Proteoglycans in cancer
    101044689 (HIF1A)
   05230 Central carbon metabolism in cancer
    101044689 (HIF1A)
   05231 Choline metabolism in cancer
    101044689 (HIF1A)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101044689 (HIF1A)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101044689 (HIF1A)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101044689 (HIF1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101044689 (HIF1A)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101044689 (HIF1A)
SSDB
Motif
Pfam: PAS_3 HIF-1a_CTAD PAS_11 HIF-1 PAS PAS_9 PAS_4 DDRGK HLH
Other DBs
NCBI-GeneID: 101044689
NCBI-ProteinID: XP_003924457
UniProt: A0A2K6U1D8
LinkDB
Position
Unknown
AA seq 826 aa
MEGASGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSSNEKLQNINLSMSPLATSETTKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQPPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQELTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
KIEHDGSLFQAVGIGTLLQQPDDHATTTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC
RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
NT seq 2481 nt   +upstreamnt  +downstreamnt
atggagggcgccagcggcgcgaacgacaagaaaaagataagttctgaacgtcgaaaagaa
aagtctcgagatgcagccagatcccggcgaagtaaagaatctgaagttttttatgagctt
gctcatcagttgccacttccacataatgtgagctcacatcttgataaggcttctgtgatg
agacttaccatcagctatttgcgtgtgaggaaacttctggatgctggtgatttggatatt
gaagatgaaatgaaagcacaaatgaattgcttttatttgaaagccttggatggttttgtt
atggttctcacagatgatggtgacatgatttacatttctgataatgtgaacaaatacatg
ggattaactcagtttgaactcactggacatagtgtgtttgattttactcatccatgtgac
catgaggaaatgagagaaatgcttacacacagaaatggccctgtgaaaaagggtaaagaa
caaaacacacagcgaagcttttttctcagaatgaagtgtactttaactagccgagggaga
actatgaacatcaagtctgcaacatggaaggtattacactgtacaggccatattcatgta
tatgataccaacagtaaccaacctcagtgtgggtataagaaaccgcctatgacctgtttg
gtgctgatttgtgaacccattcctcacccatcaaatattgaaattcctttagatagcaag
acttttctcagtcgacacagcctggatatgaaattttcttattgtgatgaaagaattacc
gaattgatgggatatgagccagaagaacttttaggccgctcaatttacgaatattaccat
gctttagactctgatcatctgaccaaaactcatcatgatatgtttactaaaggacaagtc
accacaggacagtacaggatgcttgccaaaagaggtggatatgtctgggttgaaactcaa
gcaactgtcatatacaacaccaagaactctcaaccacagtgcattgtgtgtgtaaattat
gttgtgagtggtattattcagcacgacttgattttctcccttcaacaaacagaatgtgtc
cttaaaccggttgaatcttcagatatgaaaatgactcagctattcaccaaagttgaatca
gaagatacaagtagcctctttgataaacttaagaaggaacctgatgctttaactttgctg
gccccagctgctggagacacaatcatatctttagattttggcagcaatgacacagaaact
gatgaccagcaacttgaggaagtaccattgtataatgatgtaatgcttccttcatccaat
gaaaaattacagaatatcaatttgtcaatgtctccattagccacctctgaaactacaaag
ccacttcgaagtagtgctgaccctgcactgaatcaagaagttgcattaaaattagaacca
aatccagagtcactggaactttcttttaccatgccccagattcaggatcagccacccagt
ccttctgatggaagcactagacaaagttcacctgagcctaacagtcccagtgaatattgt
ttttatgtggatagtgatatggtcaatgaattcaagttggaattggtagaaaaacttttt
gctgaagacacagaagcgaagaacccattttctactcaggacaccgatttagacttggag
atgttagctccctatatcccaatggatgatgactttcagttacgttccttcgatcagttg
tcaccattagaaagcagttctgcaagccctgaaagcgcaagccctcaaagcacagttaca
gtattccagcagactcagatacaagaacttactgctaatgccaccacgaccactgccacc
actgatgaattaaaaacagtgactaaagaccgtatggaagacattaaaatattgattgca
tctccatctcctacccacatacataaagaaactactagtgccacatcatcaccatataga
gatactcaaagccggacagcctcaccaaacagagcaggaaaaggagtcatagaacagaca
gaaaagtctcatccaagaagccctaacgtgttatctgtcgctttgagtcaaagaactaca
gttcctgaggaagaactaaatccaaagatactagctttgcagaatgctcagagaaagcga
aaaattgaacatgatggttcgctttttcaagcagtaggaattggaacattattacagcag
ccagatgatcatgcaactactacatcactttcttggaaacgtgtaaaaggatgcaaatct
agtgaacagaatggaatggagcaaaagacaattattttaataccctctgatttagcatgt
agactgctggggcaatcaatggatgaaagtggattaccacagctgaccagttatgattgt
gaagttaatgctcctatacaaggcagcagaaacctactgcagggtgaagaattactcaga
gctttggatcaagttaactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052563
Entry
101052563         CDS       T04350                                 

Gene name
EPAS1
Definition
(RefSeq) endothelial PAS domain-containing protein 1
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052563 (EPAS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101052563 (EPAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101052563 (EPAS1)
   04131 Membrane trafficking [BR:sbq04131]
    101052563 (EPAS1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101052563 (EPAS1)
Membrane trafficking [BR:sbq04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    101052563 (EPAS1)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD HIF-1 PAS PAS_9 PAS_4 HLH Corona_I
Other DBs
NCBI-GeneID: 101052563
NCBI-ProteinID: XP_003926799
UniProt: A0A2K6SWJ6
LinkDB
Position
Unknown
AA seq 867 aa
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHRLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVKVYNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRITELIGYHPEDLLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE
SLFKPHLIAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQN
FEESSTYGKAILPPSQPWATELRSTQSEAGSLPAFTVPQAAATGSTTPSATSSSSCSTPN
SPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLS
PICPEERLLPENPQSTPQHCFSTMTNIFQPLAPVASHSPFLLDKFQQQLESKKTEPEHRP
MSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPMKWAVGDQRTEFLG
AATLGPPVSPPHVSTFKTRSAKGFGARGPDMLSPAMVALSNKLKLKRQLEYEEQAFQDLS
GGDPPSGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFIQNPMRGLGQPLRHLPPP
QPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYD
CEVNVPVLGSSTLLQGGDLLRALDQAT
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgacagctgacaaggagaagaaaaggagtagctcggaaaggaggaaggagaagtcccgg
gatgctgcgaggtgccgacggagcaaggagacggaggtgttctatgagctggcccatgag
ctgcctctgccccacagcgtaagctcccatctggacaaggcctccatcatgcggctggcg
atcagcttcctgcgaacacacaggctcctctcctcagtttgctctgaaaacgagtctgaa
gccgaagctgaccagcagatggacaacttgtacctgaaagctttggagggtttcattgct
gtggtgacccaagatggtgacatgatctttctgtcagaaaacatcagcaagttcatggga
ctcacacaggtggagctaacaggacatagcatcttcgacttcactcatccctgcgaccat
gaggagattcgtgagaacctgagtctcaaaaacggatctggttttgggaaaaaaagcaaa
gacatgtccacagagcgggacttcttcatgaggatgaagtgcacagtcaccaacagaggc
cgaaccgtcaacctcaagtcagccacctggaaggtcttgcactgcacgggccaggtgaaa
gtctacaacaactgccctcctcacagcagtctgtgtggctacaaagagcccctgctgtcc
tgcctcatcatcatgtgtgagccgatccagcacccatcccacatggacatccccctggac
agcaagacctttctgagccgccacagcatggacatgaagtttacctactgtgatgacaga
atcacagaactgattggttaccaccctgaggacctgctcggccgctcagcctatgaattc
taccacgcgctagactccgagaacatgaccaagagtcaccagaacttgtgcaccaagggt
caggtagtaagtggccagtaccggatgctcgcaaagcatgggggctatgtgtggctggag
acccaggggacggtcatctacaaccctcgcaacctgcagccccagtgcatcatgtgtgtc
aactacgtcctgagtgagattgagaagaatgacgtggtgttctccatggaccagacggaa
tccctgttcaagccccacctgatagccatgaacagcatctttgacagcagtggcaagggg
gctgtgtctgagaagagtaacttcctgttcaccaagctaaaggaggagcccgaggagctg
gcccagctcgcccccacgccaggagacgccatcatctctctggatttcgggaatcagaac
tttgaggagtcctcaacctatggcaaggccatcttgcccccaagccagccgtgggccaca
gagttgaggagcacccagagcgaggctgggagcctgcctgccttcaccgtgccccaggca
gccgcgacgggcagcaccactcccagtgccaccagcagcagcagctgctccacgcccaac
agccctgaagactattacacctctctggataacgacctgaagattgaagtgattgagaag
ctctttgccatggacacagaggccaaggaccaatgcagcacccagacggatttcaatgag
ctggacttggagacactggcaccctacatccctatggacggggaagacttccagctaagc
cccatctgccccgaggagcggctcttgccggagaacccacagtccaccccccagcactgc
ttcagcaccatgacaaacatcttccagccactggcccctgtagcctcgcacagtcccttc
ctcctggacaagtttcagcagcagctggagagcaagaagacagagcccgagcaccggccc
atgtcctccatcttctttgacgcaggaagcaaagcatccctgcctccatgctgtggccag
gccagcacccctctctcttccatggggggcagatccaacacccagtggcccccagatcca
ccattacattttgggcccatgaagtgggctgtcggggatcagcgcacagagttcttggga
gcagcgacattggggccccctgtctccccgccccatgtctccacattcaagacaaggtct
gcaaagggtttcggggctcgaggcccagacatgctgagcccggccatggtagccctctcc
aacaagctgaagctgaagcgacagctggagtatgaagagcaagcctttcaggacctgagc
gggggggacccacccagtggcagcacttcacatttgatgtggaaacggatgaagaacctc
aggggcgggagttgccctttgatgccggacaagccgctgagtgcaaatgtccccaatgat
aagttcatccaaaaccccatgaggggcctgggccagcccctgagacacctgccgccgcca
cagcccccatctgccatcagccctggggagaacagcaagagcaggttccccccacagtgc
tacgccacccagtaccaggattacagcctgtcatcagctcacaaggtgtcaggcatggca
agccgtctgctcgggccctcatttgaatcctacctgctgcccgaactgaccagatatgac
tgtgaggtgaacgtgcccgtgctgggaagctccacgctcctgcaaggaggggacctcctc
agagccctggaccaggccacctga

DBGET integrated database retrieval system