KEGG   Shewanella baltica OS678: Sbal678_2092Help
Entry
Sbal678_2092      CDS       T01725                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00473  D-Alanine metabolism
sbt00550  Peptidoglycan biosynthesis
sbt01100  Metabolic pathways
sbt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sbt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Sbal678_2092
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal678_2092
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Sbal678_2092
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sbt01011]
    Sbal678_2092
Enzymes [BR:sbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Sbal678_2092
Peptidoglycan biosynthesis and degradation proteins [BR:sbt01011]
 Precursor biosynthesis
  Amino acid ligase
   Sbal678_2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ADT94249
LinkDB All DBs
Position
complement(2449674..2450687)
Genome map
AA seq 337 aa AA seqDB search
MSKINLLLLCGGGSAEHDISLMSANYFETSLAKSEQFSVLRVELDKFGQYRTAAGDDCEL
TNSREIRFRDESKTPWPVDYVIPCIHGYPGETGDIQSYFNLIQLPYFGCESEASSNCFNK
ITAKMWFSALGIPNTPYIFLNQFDDAAIEQTQAALAQWGSIFVKAASQGSSVGCYKVDDS
DKVAGVLKDAFGYAPYVIVEKTIKARELEVAVYEYNGEVVATVPGEIICDTNTFYTFDEK
YAKNSKARTDVVAQHVSAEISEQIRAYAIKAFKGMKLRHLSRIDFFLTADNEILLNEINT
FPGSTPISMFPKMLQNHGHDFTEYLSLVINGQLTAKS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagatcaatctacttttgctgtgcggcggcggaagtgccgaacacgatatttca
ttaatgtcggccaactattttgaaacctcactggcaaaatctgagcagttttccgtgttg
cgagtcgagctggataaattcggccagtaccgcactgccgctggtgacgactgtgagctg
accaatagccgcgagattcgcttccgtgatgaaagcaaaacgccatggccagtcgattac
gtcattccttgcattcatggctatcccggcgagactggcgacattcaatcctattttaat
ctgatccaactgccctattttggctgtgaatccgaagcgagcagtaactgcttcaataag
atcaccgctaaaatgtggttctcggccttaggtattcctaatacgccgtatattttcctg
aatcagttcgatgatgcggcgattgagcaaacccaagcagcattggcacaatggggatcg
atcttcgttaaagcggcctcgcagggttcctctgtcggttgttacaaagtggatgacagc
gataaagttgcaggcgtgcttaaggatgcgtttggctatgcaccctatgtgatcgttgaa
aaaaccataaaagcccgcgagttagaagtagccgtctacgagtacaatggtgaagtggtg
gcgacagtgccaggtgaaatcatctgtgataccaacaccttctacaccttcgatgagaaa
tacgccaaaaacagtaaagcgcgcaccgatgtggtcgcgcagcatgtgtcagctgagatc
agtgaacaaatccgcgcctatgcaatcaaggcatttaaaggaatgaagctgcgtcactta
tcgcgcatcgactttttcttaaccgcggacaatgaaattctattgaatgaaatcaatact
ttcccaggttctacgccgatttctatgttccctaaaatgctgcaaaatcacggtcacgac
tttactgaatacttgagtctagtgattaacggtcagctaaccgctaaatcttag

DBGET integrated database retrieval system