KEGG   Sphingobacteriaceae bacterium GW460-11-11-14-LB5: CA265_07875Help
Entry
CA265_07875       CDS       T05546                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sbx  Sphingobacteriaceae bacterium GW460-11-11-14-LB5
Pathway
sbx00564  Glycerophospholipid metabolism
sbx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CA265_07875
Enzymes [BR:sbx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CA265_07875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA Pyr_redox_2 Pyr_redox_3 HI0933_like NAD_binding_8 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ARS39571
UniProt: A0A1X9Z3L5
LinkDB All DBs
Position
complement(1965602..1967194)
Genome map
AA seq 530 aa AA seqDB search
MKRLHPHHIAENINWDFIIIGGGATGLGTALDAASRGFKTLLVEQSDFAKGTSSRSTKLV
HGGVRYLAQGDIGLVKHALKERGLLQQNAKHLVNKEEFLIPCYDWFSVVKYLTGLTLYDW
LAGKYSFGKSKFFSKKETLTMMPGIKEKGLKGSIRYYDGKFDDARLAINIAQTAIENGAS
LLNYTKVTGLLKSGDQVTGIETEDTITGLTAKYNGKIVINATGVFVDDILQMNNPNSKKM
VRPSQGVHVVLDKSFLNSESALMIPKTSDGRVLFAVPWHDHLLVGTTDTPLDEHSLEPRA
LKKEVDFIMSTAASYFNRKPLEKDILSVFSGLRPLAAPTNGDGNSTKEISRDHKLIVSAK
GLITITGGKWTTYRRMAEETVDLAITHGGLESKACVTQNLSIHGSSTTTGDHHLAIYGTD
RSKIEALIVQDPGLGNKLNPAFPFTEAEVIWSARNEMAETVEDILSRRLRILFINAQAAK
DMAPRVASLLAQELSADKNWETNQIETFNKLADGYIYHSTPKITESALAN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattacacccgcatcatatcgcagaaaacataaattgggacttcattattatt
ggcggaggtgctacaggtttgggcactgcattagacgctgcaagccggggttttaaaact
ttactcgtagagcaatcagattttgccaaaggaacatccagcaggagtactaaactggta
catggtggtgtgcgctatcttgcccagggtgatatcggtttggttaaacatgcattaaaa
gaacgtggcctgttacaacaaaatgcgaaacacctggtaaataaagaagaatttctgatt
ccctgctacgattggttctctgttgtaaaatatttaaccggacttacgctttacgattgg
ttagcaggcaaatatagctttggcaaatctaagtttttctctaaaaaagaaactctaacc
atgatgcctggcattaaggagaagggattaaaaggaagcatcaggtattacgacggcaag
tttgatgatgcccgtttagcgataaacattgcacaaaccgctattgaaaacggtgcatcg
ttattgaattatacaaaggtaaccggcttattaaaaagtggtgatcaggttactggtatt
gaaacagaagacaccatcactggtttaacggcaaaatataatggcaaaatagtgattaat
gccacgggagtgtttgtggatgatatccttcaaatgaataacccgaattcaaaaaaaatg
gtgcgccccagccagggtgtacatgtggtgttagataaaagttttttaaatagcgaatcg
gccttaatgatacccaaaacctctgatggacgtgttttatttgctgttccatggcacgat
catttgttggtgggcacaacagacacgccattagacgaacatagtttagaacccagggca
cttaaaaaagaagtagattttattatgagtactgcggcgagttattttaaccgcaaacct
ttggaaaaagatattttaagtgtattctcaggtttacgtcctttggctgctcctaccaac
ggcgatggaaacagtacgaaagaaattagcagagaccataaactgattgtttcagcaaag
ggattgataaccattaccggtgggaaatggacgacctatcgccgaatggcagaagaaact
gtagatttagccatcacccatggcggtttagaatcgaaagcatgtgtaactcaaaattta
agcatacacggcagttcaaccactaccggagatcatcatttagctatatatggcactgat
cgcagtaaaattgaagctttaattgtgcaagatccaggccttggaaataaattaaatccg
gcattcccttttactgaagctgaagtgatttggtctgcacgaaatgaaatggccgaaacg
gtagaagatattttaagcagacgattaaggatactatttattaatgcgcaggcagccaaa
gatatggcgcccagagtagcttccctcctggcccaagaattatctgccgataaaaactgg
gaaactaaccaaatcgaaacttttaataaattagccgatggttatatttaccattcaaca
cctaaaataaccgaatcggctttagccaattaa

DBGET integrated database retrieval system