KEGG   Serinus canaria (common canary): 103814927Help
Entry
103814927         CDS       T05755                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
scan  Serinus canaria (common canary)
Pathway
scan04010  MAPK signaling pathway
scan04020  Calcium signaling pathway
scan04114  Oocyte meiosis
scan04140  Autophagy - animal
scan04261  Adrenergic signaling in cardiomyocytes
scan04270  Vascular smooth muscle contraction
scan04310  Wnt signaling pathway
scan04340  Hedgehog signaling pathway
scan04371  Apelin signaling pathway
scan04530  Tight junction
scan04540  Gap junction
scan04910  Insulin signaling pathway
scan04912  GnRH signaling pathway
scan04914  Progesterone-mediated oocyte maturation
scan04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:scan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103814927 (PRKACB)
   04310 Wnt signaling pathway
    103814927 (PRKACB)
   04340 Hedgehog signaling pathway
    103814927 (PRKACB)
   04371 Apelin signaling pathway
    103814927 (PRKACB)
   04020 Calcium signaling pathway
    103814927 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103814927 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103814927 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103814927 (PRKACB)
   04540 Gap junction
    103814927 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103814927 (PRKACB)
   04912 GnRH signaling pathway
    103814927 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    103814927 (PRKACB)
   04916 Melanogenesis
    103814927 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103814927 (PRKACB)
   04270 Vascular smooth muscle contraction
    103814927 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scan01001]
    103814927 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:scan03019]
    103814927 (PRKACB)
   03036 Chromosome and associated proteins [BR:scan03036]
    103814927 (PRKACB)
Enzymes [BR:scan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103814927 (PRKACB)
Protein kinases [BR:scan01001]
 Serine/threonine kinases: AGC group
  PKA family
   103814927 (PRKACB)
Messenger RNA biogenesis [BR:scan03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103814927 (PRKACB)
Chromosome and associated proteins [BR:scan03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103814927 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 103814927
NCBI-ProteinID: XP_009086835
LinkDB All DBs
Position
Unknown
AA seq 396 aa AA seqDB search
MAGHKEVPCSQGTATALQRLEGFANRLFHRHSKNGAHEQRAALENESQQCSEFTVRWDES
MKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMKIL
DKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRR
IGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGR
TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGK
VRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPF
IPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcagggcacaaggaggtcccttgtagccagggcacggccacagcactgcagagactg
gaagggtttgctaaccgcctcttccataggcactccaagaatggtgcgcatgagcagagg
gcggctctggaaaatgagagccagcagtgctctgagttcactgtccggtgggacgaatca
atgaaagagttcttagccaaagccaaagaagactttttaagaaaatgggaaagcccccct
cagaatactgctggcctagatgattttgagcggcaaaaaacccttggaacaggatcattt
gggagagtaatgatggtgaaacataaatccacagaacagtattatgctatgaagatactg
gacaaacagaaggttgtcaaactgaagcagatagaacacacactgaatgagaagaggata
ttacaagcagtgaactttcctttccttgttaaactggagtattcttttaaggacaattct
aatttatacatggtaatggagtatgttcctggtggagaaatgttttcacatctaagaaga
atcggaaggttcagtgaaccacatgcacggttttatgcagctcagatagtgctaacattt
gagtacctccattcattagacctcatctacagagatctaaagcctgaaaatcttttaatt
gatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaaggcaga
acttggacgttatgtgggactccagaatacctggcacctgaaataattctcagcaagggt
tacaacaaggcagtggattggtgggcactaggagtgttaatctatgaaatggcagctgga
tatcccccattctttgcagatcagcccattcaaatttacgagaagattgtgtctggcaag
gtgaggttcccatcacacttcagttcagacctaaaggatcttctaagaaatttactccag
gtagatttgaccaaacgatatggaaatctcaagaatggtgtaaatgacataaaaaatcac
aagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagctccattc
ataccaaagtgcagaggtcctggagataccagcaactttgatgactatgaagaagaagat
attcgtgcttctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system