KEGG   Serinus canaria (common canary): 103817139
Entry
103817139         CDS       T05755                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
scan  Serinus canaria (common canary)
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2 Mst1_SARAH
Other DBs
NCBI-GeneID: 103817139
NCBI-ProteinID: XP_030083964
LinkDB
Position
Unknown
AA seq 294 aa
CYPCHHVPALVPPVPSALTLTARICTVVTLLLSLSPDCSFTCHYRCRALVQLDCSGPPGA
GDEDDGNEQVLEKDTNVDEPSEWEKAELDQAQVEQRIKEYNSQINSNLFMSLNKDGSYTG
FIKVQLKLVRPVSVPATKRVPSLQAGRPHPQGVKRRTSFYLPKGTVKHLHILSHTRASEV
IDALLRKFTVIDNPRKFALFERSEKDEQVYLRKLGDDEQPLRLRLLAGPSEKVLSFILKE
NETGEVNWDAFSLPELHNFLLILQREEEEHVRRLRHRYARCRQKMQEALAALTE
NT seq 885 nt   +upstreamnt  +downstreamnt
tgctacccctgtcaccatgtgccagcccttgtcccaccagtgcccagtgccctgaccctg
acagccaggatctgcacagtggtgaccctgctcctgtctctgtccccagactgcagcttc
acctgccactaccggtgccgggccctagttcagctggactgcagtggccccccaggtgct
ggtgacgaggatgatggcaatgagcaggtgttggagaaggacaccaatgtggatgagccc
agcgagtgggagaaggcagagctggatcaggcgcaggtggagcagcggatcaaggagtac
aacagccaaatcaacagcaacctcttcatgagcctgaacaaagacggctcctacaccggc
ttcatcaaggtgcagctgaagctggttcgccctgtctcggtgccggccaccaagcgggtc
ccctccctgcaggcggggcggccacacccccagggggtgaagcgccgcacgtccttctac
ctgcccaaggggaccgtcaagcacctgcacatcctctcgcacacccgcgccagcgaggtc
atcgatgcgctcctccgcaagttcaccgtcattgacaatccccgcaagtttgccctcttc
gagaggtctgagaaggatgagcaagtgtatctgcggaagctgggtgacgacgagcagccc
ctgcggctgcggctgctggccggccccagcgagaaggtgctgagcttcattctgaaggag
aacgagaccggcgaggtgaactgggacgccttctcgctgccggagctgcacaacttcctg
ctgatcctgcaacgggaggaggaggagcacgtgcggcggctgcggcatcgctacgcgcgc
tgccgccagaagatgcaggaggcgctggccgcgctcacagagtga

DBGET integrated database retrieval system