KEGG   Streptomyces scabiei: SCAB_39881Help
Entry
SCAB_39881        CDS       T01187                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
scb  Streptomyces scabiei
Pathway
scb00250  Alanine, aspartate and glutamate metabolism
scb00410  beta-Alanine metabolism
scb00430  Taurine and hypotaurine metabolism
scb00650  Butanoate metabolism
scb01100  Metabolic pathways
scb01110  Biosynthesis of secondary metabolites
scb01120  Microbial metabolism in diverse environments
scb02024  Quorum sensing
Module
scb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCAB_39881
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCAB_39881
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAB_39881
   00430 Taurine and hypotaurine metabolism
    SCAB_39881
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCAB_39881
Enzymes [BR:scb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SCAB_39881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CBG71067
UniProt: C9Z0V4
LinkDB All DBs
Position
4480854..4482293
Genome map
AA seq 479 aa AA seqDB search
MPLHRWDSDDARDGGNGRKDGHRLAVNPFYGQANPAGGMTEAPPKHRLPDAPLPPSTAYQ
LVHDELMLDGNSRLNLATFVTTWMEPEAGVLMGECRDKNMIDKDEYPRTAELERRCVSML
ADLWNAPDPAAAVGCSTTGSSEACMLAGMALKRRWAKRNADRYPSADARPNLVMGVNVQV
CWEKFCNFWEVEARQVPMEGDRFHLDPAAAAALCDENTIGVVGVLGSTFDGSYEPIAELC
AVLDDLQERTGLNVPVHVDGASGAMVAPFLDEELVWDFRLPRVASINTSGHKYGLVYPGV
GWALWRSAEELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGFRAVQQ
STRDVATLLAQQVGGFGDFRLLTRGDELPVFAFTTNEDVTAYDVFDVARRMRERGWLVPA
YTFPENREDLSVLRVVCRNGFTSDLAGLFMEDLGSLLPELRRQRGPLTRDAGAATGFHH
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcaccgatgggacagcgacgacgcgcgggacggcgggaacggccggaaggac
ggacaccggctcgccgtgaaccccttctacggccaggccaacccggcgggcgggatgacc
gaggccccgcccaagcaccggctccccgacgccccgctgcccccctcgacggcgtaccag
ctcgtccacgacgaactcatgctggacggcaactcgcggctcaacctcgccaccttcgtc
accacctggatggagcccgaggccggggtcctgatgggtgagtgccgggacaagaacatg
atcgacaaggacgagtacccgcggacggccgagctggagcggcgctgtgtgtcgatgctc
gccgatctgtggaacgcgccggacccggccgccgccgtcggctgctcgaccaccgggtcc
agtgaggcctgcatgctcgccgggatggccctcaagcggcggtgggcgaagcggaacgcc
gaccggtatccctcggcggacgcccggcccaacctcgtgatgggcgtcaacgtccaggtc
tgctgggagaagttctgcaacttctgggaggtcgaggcccggcaggtgcccatggagggc
gaccggttccatctcgacccggcggcggccgcggcgctgtgcgacgagaacacgatcggg
gtcgtgggtgtcctcggctcgaccttcgacgggtcgtacgagccgatcgcagagctgtgc
gcggtccttgacgatctgcaggaacgtacggggctgaacgtgcccgtccacgtcgacggc
gcgtccggcgcgatggtggcgcccttcctcgacgaggagctggtctgggacttccggctc
ccccgggtcgcgtcgatcaacacctcggggcacaagtacgggctggtgtaccccggggtc
ggctgggcgctgtggcggtccgccgaggagctgccggaggagctggtgttccgggtgaac
tacctgggcggggacatgcccacgttcgcgctgaacttctcgcggcccggggcgcaggtc
gtcgcgcagtactacacgttcctgcggctggggcgtgaggggttccgcgcggtgcagcag
tcgacgcgggacgtggcgacgctgctcgcgcagcaggtcggcgggttcggggacttccgg
ctcctcacacggggcgacgagttgccggtgttcgcgttcaccacgaacgaggacgtcacc
gcgtacgacgtcttcgacgtggcccggcggatgcgggagagggggtggctggtgccggcc
tacacgttcccggagaaccgggaggatctgtccgtgctgcgggtggtgtgccgcaacggg
ttcacgtcggatctcgcggggttgttcatggaggacctcggcagcctgttgcccgaactg
cggcggcagcgggggccgttgacgcgggatgcgggggcggcgacggggttccaccactag

DBGET integrated database retrieval system