KEGG   Saccharomyces cerevisiae (budding yeast): YBR045C
Entry
YBR045C           CDS       T00005                                 

Gene name
GIP1
Definition
(RefSeq) protein phosphatase regulator GIP1
  KO
K12770  GLC7-interacting protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YBR045C (GIP1)
SSDB
Other DBs
NCBI-GeneID: 852334
NCBI-ProteinID: NP_009601
SGD: S000000249
UniProt: P38229
LinkDB
Position
II:complement(328173..330092)
AA seq 639 aa
METILQPKARPFESLKRKRFREWLRPSTAHGSLLHSDTLDLRDFAKPNPADTFSNLDSGH
CPLVTTPIKYECPDGKSSFFRGDTKFETLFSNRKFYEFKDNLKRGLKKIRHGRNGHQSEK
RCPVVEETKKSVSDNLDKPDNNTPCFDRFHTNSKEFETQFDHSNRSQNSEKAYLDNESCW
NLSEKFIPFNNLKYEDLKHFEENLQSLAPATFTPIESNESLDRSDSTRGTKRSIRNDSSD
TTSEKRLCLKQYSDEPESDHSMESTPSIYITKEVQERIEALSSTDSFLIEKVDFPSNKIG
SSASDYESDNEYRNMDEDSINDVTTEKEGNVVIPDSNTSTVDAMEKPIEVSSALKDDTLD
KDIDDASSSYSDDVETTFEPVESEELSDLSDTSSSGSSKIYTIPTFRGLTNRTNISQILS
KVGKADLSQDNLTHLIKSHQKKKRCVNFRNKRFYDAFNPYVDNEEDAELSDSENISEMDT
DLCIKDRSTSSVRFDENSRLLIYKKSKKLNKDETQSGYSTTEMRSILKTKMNSQHDEESQ
RASKCDTVGVAQFLHYFQYTEYKRQRNEAENYRLRGEQLSKYYSEEYPLDFAAVECEDSV
NDKSDIILSMRATERNIGRQLKGISSQGAQIISLDEDVF
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggaaactattttgcagccaaaggctagaccatttgagtctttgaaaagaaaacgtttt
agagaatggttgaggccgtcgactgcgcatggatccctgttgcattctgatacattagat
ttgcgtgactttgcaaaacctaatcccgctgacacattttctaatcttgattctggtcat
tgtcctttggtcacaactccaataaaatatgagtgcccagatggaaagagttcttttttc
cgaggagacactaaatttgaaaccctgttcagtaatagaaaattctatgagttcaaagat
aatttgaaaaggggattgaagaaaatacgtcatgggagaaacggacatcaaagcgaaaag
agatgtccagttgttgaagaaacaaaaaagtctgtgtcagataatctggacaaaccagac
aataatacgccctgtttcgacagattccacacaaattcgaaagaatttgaaacgcaattt
gatcattcaaataggagccaaaattccgagaaggcttatctagacaatgaatcctgttgg
aacctaagtgagaaatttattccttttaataatttaaaatatgaagatttgaaacatttt
gaagagaatttgcaaagcttagcgcctgcaacttttactccaattgaatcaaatgaatcg
cttgataggtcagattcgacacgtggcacaaaacgaagcattcgcaatgattccagtgat
acaacatctgaaaagaggctatgcttaaaacaatactcagatgaacctgaatcggatcat
tcgatggaaagtacaccatccatttacattaccaaagaagttcaagaaagaattgaagca
ttaagctccacggattcgtttttaattgaaaaagtagattttccctctaacaaaattggt
tccagtgcctccgattatgaaagtgataacgaatacagaaatatggatgaggattcaata
aacgatgttaccactgagaaagagggaaatgtggtcataccagactctaatactagcacg
gtggacgcaatggaaaaaccaattgaagtgagctcggccttaaaagatgatacattggat
aaagacatagatgatgcgagcagtagctattcggatgatgtagagaccacattcgagcca
gttgaatctgaggaactttccgatttatctgatacaagctcaagtggaagtagtaaaatt
tatactatccccacatttcgcggccttactaataggaccaatatatcacaaattctttca
aaagttggtaaagctgatttaagccaagataacttaacgcatttgatcaaaagtcatcaa
aaaaagaaaagatgcgtgaattttagaaataaaagattctatgatgctttcaatccatat
gttgataacgaagaagatgcagagttatctgacagcgaaaacatttcagaaatggataca
gatctttgtataaaggatcggagtacctcaagtgttaggtttgatgaaaactcacgtctt
ttaatctacaaaaaatctaaaaagttaaacaaagatgagactcaaagtggttattcgact
actgaaatgaggtcaattctaaagacaaagatgaattcacagcatgatgaggagtctcag
agagcttcgaagtgtgacacagtaggtgtagcccaatttttacattattttcaatataca
gagtataaaaggcagagaaatgaagcagaaaattatagactgagaggagagcaactaagc
aagtactattctgaagaatatcctttggattttgcggctgttgaatgcgaagattccgtt
aatgataaatctgatatcatacttagtatgagagctacggaaagaaacattggtaggcaa
ctgaaaggtataagtagtcaaggggcacaaattatatcgcttgatgaggatgttttttga

DBGET integrated database retrieval system