KEGG   Saccharomyces cerevisiae (budding yeast): YBR060C
Entry
YBR060C           CDS       T00005                                 

Gene name
ORC2, RRR1, SIR5
Definition
(RefSeq) origin recognition complex subunit 2
  KO
K02604  origin recognition complex subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBR060C (ORC2)
   04113 Meiosis - yeast
    YBR060C (ORC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YBR060C (ORC2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YBR060C (ORC2)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YBR060C (ORC2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YBR060C (ORC2)
SSDB
Motif
Pfam: ORC2 AT_hook
Other DBs
NCBI-GeneID: 852352
NCBI-ProteinID: NP_009616
SGD: S000000264
UniProt: P32833
LinkDB
Structure
PDB: 
5ZR1 5V8F

Position
II:complement(360652..362514)
AA seq 620 aa
MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNT
SPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEES
KTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSL
TTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFL
DTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKM
FPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPC
LILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKL
ILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDI
SNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLS
ANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEII
WVPYTYAELEKLLKTVLNTL
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgctaaatggggaagactttgtagagcataatgatatcctatcgtctccggcaaaaagc
aggaatgtaaccccaaaaagggttgacccacatggagaaagacaactgagaagaattcat
tcatcaaagaagaatttgttggaaagaatctcgcttgtaggcaacgaaaggaaaaataca
tctccagatccggcactcaaacctaaaacgccaagtaaagctccccgtaaacgtggaaga
ccaagaaagatacaggaagaattaactgataggatcaagaaggatgagaaagatacaatt
tcctctaagaaaaagaggaaattggacaaagatacatcaggtaatgtcaatgaggaaagc
aagacttctaacaacaagcaggtgatggaaaagacggggataaaagagaaaagagaacgc
gaaaaaatacaggtagcgaccacaacatatgaagataatgtgactccacaaactgatgat
aattttgtatcaaattcacccgagccaccagaacctgcaacaccatctaagaagtcttta
accactaatcatgattttacttcgcccctaaagcaaattataatgaataatttaaaagaa
tataaagactcaacctccccaggtaaattaaccttgagtagaaattttactccaacccct
gtaccgaaaaataaaaagctctaccaaacttcggaaaccaagtcagcaagctcgtttttg
gatacttttgaaggatatttcgaccaaagaaaaattgtcagaactaatgcgaagtcaagg
cacaccatgtcaatggcacctgacgttaccagagaagagttttccctagtatcaaacttt
ttcaacgaaaattttcaaaaacgtcccaggcaaaagttatttgaaattcagaaaaaaatg
tttccccagtattggtttgaattgactcaaggattctccttattattttatggtgtaggt
tcgaaacgtaattttttggaagagtttgccattgactacttgtctccgaaaatcgcgtac
tcgcaactggcttatgagaatgaattacaacaaaacaaacctgtaaattccatcccatgc
cttattttaaatggttacaaccctagctgtaactatcgtgacgtcttcaaagagattacc
gatcttttggtccccgctgagttgacaagaagcgaaactaagtactggggcaatcatgtg
attttgcagatccaaaagatgattgatttctacaaaaatcaacctttagatatcaaatta
atacttgtagtgcataatctggatggtcctagcataaggaaaaacacttttcagacgatg
ctaagcttcctctccgtcatcagacaaatcgccatagtcgcctctacagaccacatttac
gctccgctcctctgggacaacatgaaggcccaaaactacaactttgtctttcatgatatt
tcgaattttgaaccgtcgacagtcgagtctacgttccaagatgtgatgaagatgggtaaa
agcgataccagcagtggtgctgaaggtgcgaaatacgtcttacaatcacttactgtgaac
tccaagaagatgtataagttgcttattgaaacacaaatgcagaatatggggaatctatcc
gctaacacaggtcctaagcgtggtactcaaagaactggagtagaacttaaacttttcaac
catctctgtgccgctgattttattgcttctaatgagatagctctaaggtcgatgcttaga
gaattcatagaacataaaatggccaacataactaagaacaattctggaatggaaattatt
tgggtaccctacacgtatgcggaacttgaaaaacttctgaaaaccgttttaaatactcta
taa

KEGG   Saccharomyces cerevisiae (budding yeast): YHR118C
Entry
YHR118C           CDS       T00005                                 

Gene name
ORC6
Definition
(RefSeq) origin recognition complex subunit 6
  KO
K02608  origin recognition complex subunit 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YHR118C (ORC6)
   04113 Meiosis - yeast
    YHR118C (ORC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YHR118C (ORC6)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YHR118C (ORC6)
SSDB
Motif
Pfam: ORC6
Other DBs
NCBI-GeneID: 856518
NCBI-ProteinID: NP_011986
SGD: S000001160
UniProt: P38826
LinkDB
Structure
PDB: 
5ZR1 5V8F

Position
VIII:complement(344321..345628)
AA seq 435 aa
MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHI
CAYIASQKMNEKHMPDLCYYIDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKN
KRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKL
AFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRS
GRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAY
KIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVD
DVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFRKLGSMLQTTNILVTDDQYNI
WKKRIEMDLALTEPL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtccatgcaacaagtccaacattgtgtcgcagaagtacttcgactagatccacaagaa
aaaccggactggtcgagcggatatttgaagaagttgactaatgcgacatcgattttatat
aatacttcactgaacaaggtaatgctgaaacaagatgaagaggttgctagatgtcacata
tgtgcatacatagcgtcacagaaaatgaatgaaaaacacatgcctgacctttgctattat
atagacagtattcccttggagccgaaaaaagccaagcatttaatgaaccttttcagacaa
agtttatctaattcttcacctatgaaacaatttgcttggacaccgagccccaaaaagaac
aaacgcagtccagtaaagaacggtgggaggtttacttcttctgatccgaaagagttgagg
aatcaactgtttggtacaccaactaaagttaggaaaagccaaaataatgattcgttcgta
ataccagaactaccccccatgcaaaccaatgaatcgccgtctattactaggagaaagtta
gcatttgaagaggatgaggatgaggatgaagaggaaccaggaaacgacggtttgtcttta
aaaagccatagtaataagagcattactggaaccagaaatgtagattctgatgagtatgaa
aaccatgaaagtgaccctacaagtgaggaagagccattaggtgtgcaagaaagcagaagc
gggagaacgaaacaaaataaggcagttggaaaaccgcaatcagaattgaagacggcaaaa
gccctgaggaaaaggggcagaataccaaattctttgttagtaaagaagtattgcaaaatg
actactgaagaaataatacggctttgcaacgattttgaattaccaagagaagtagcatat
aaaattgtggatgagtacaacataaacgcgtcaagattggtttgcccatggcaattagtg
tgtgggttagtattaaattgtacattcattgtatttaatgaaagaagacgcaaggatcca
agaattgaccattttatagtcagtaagatgtgcagcttgatgttgacgtcaaaagtggat
gatgttattgaatgtgtaaaattagtgaaggaattaattatcggtgaaaaatggttcaga
gatttgcaaattaggtatgatgattttgatggcatcagatacgatgaaattatatttagg
aaactgggatcgatgttacaaaccaccaatattttggtcacagacgaccagtacaatatt
tggaagaaaagaattgaaatggatttggcattaacagaacctttataa

KEGG   Saccharomyces cerevisiae (budding yeast): YLL004W
Entry
YLL004W           CDS       T00005                                 

Gene name
ORC3
Definition
(RefSeq) origin recognition complex subunit 3
  KO
K02605  origin recognition complex subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLL004W (ORC3)
   04113 Meiosis - yeast
    YLL004W (ORC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YLL004W (ORC3)
   03036 Chromosome and associated proteins [BR:sce03036]
    YLL004W (ORC3)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YLL004W (ORC3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YLL004W (ORC3)
SSDB
Motif
Pfam: ORC_WH_C
Other DBs
NCBI-GeneID: 850656
NCBI-ProteinID: NP_013097
SGD: S000003927
UniProt: P54790
LinkDB
Structure
PDB: 
5ZR1 5V8F

Position
XII:141073..142923
AA seq 616 aa
MSDLNQSKKMNVSEFADAQRSHYTVYPSLPQSNKNDKHIPFVKLLSGKESEVNVEKRWEL
YHQLHSHFHDQVDHIIDNIEADLKAEISDLLYSETTQKRRCFNTIFLLGSDSTTKIELKD
ESSRYNVLIELTPKESPNVRMMLRRSMYKLYSAADAEEHPTIKYEDINDEDGDFTEQNND
VSYDLSLVENFKRLFGKDLAMVFNFKDVDSINFNTLDNFIILLKSAFKYDHVKISLIFNI
NTNLSNIEKNLRQSTIRLLKRNYHKLDVSSNKGFKYGNQIFQSFLDTVDGKLNLSDRFVE
FILSKMANNTNHNLQLLTKMLDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTF
MFFVEGLIKQHAPADEILSLLTNKNRGLEEFFVEFLVRENPINGHAKFVARFLEEELNIT
NFNLIELYHNLLIGKLDSYLDRWSACKEYKDRLHFEPIDTIFQELFTLDNRSGLLTQSIF
PSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDF
YIAFRETLPKEEILNFIRKDPSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQ
STKSYDLVEKCVWRGI
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgagcgaccttaaccaatccaaaaagatgaacgtcagcgagtttgctgacgcccaaagg
agccactatacagtataccccagtttgcctcaaagtaacaaaaatgataaacacattccc
tttgtcaaacttctatcaggcaaagaatcggaagtgaacgtggaaaaaagatgggaattg
tatcatcagttacattcccactttcatgatcaagtagatcatattatcgataatattgaa
gcagacttgaaagcagagatttcagaccttttatatagtgaaactactcagaaaaggcga
tgctttaacactattttcctattaggttcagatagtacgacaaaaattgaacttaaagac
gaatcttctcgctacaacgttttgattgaattgactccgaaagaatctccgaatgtaaga
atgatgcttcgtaggtctatgtacaaactttacagcgcagctgatgcagaagaacatcca
actatcaagtatgaagacattaacgatgaagatggcgattttaccgagcaaaacaatgat
gtatcatacgatctgtcacttgtggaaaacttcaaaaggctttttggaaaagacttagca
atggtatttaattttaaagatgtagattctattaacttcaacacattggataacttcata
attctattgaaaagtgccttcaagtatgaccatgttaaaataagtttaatctttaatatt
aatacaaacttgtcaaatattgagaaaaatttgagacaatcaaccatacgacttctgaag
agaaattatcataaactagacgtgtcgagtaataaaggatttaagtacggaaaccaaatc
tttcaaagctttttggatacggttgatggcaaactaaatctttcagatcgttttgtggaa
ttcattctcagcaagatggcaaataatactaatcacaacttacaattattgacgaagatg
ctggattattcgttgatgtcgtactttttccagaatgccttttcagtattcattgaccct
gtaaatgttgattttttgaacgacgactacttaaaaatactgagcagatgtcctacattc
atgttctttgtcgaaggtcttataaagcagcatgctcctgctgacgaaattctttcatta
ttgacaaacaaaaacagaggcctagaagagttttttgttgagtttttggtaagagagaac
ccgattaacgggcatgctaagtttgttgctcgattcctcgaagaagaattgaatataacc
aattttaatctgatagaattatatcataatttgcttattggcaaactagactcctatcta
gatcgttggtcagcatgtaaagagtataaggatcggcttcattttgaacccattgataca
atttttcaagagctatttactttggacaacagaagtggattacttacccagtcgattttc
ccttcttacaagtcaaatatcgaagataacttactaagttgggagcaggtgctgccttcg
cttgataaagaaaattatgatactctttctggagatttggataaaataatggctccggta
ctgggtcagctattcaagctttatcgtgaggcgaatatgactatcaacatttacgatttc
tacattgcgttcagagaaacattaccaaaagaggaaatattaaatttcataagaaaagat
ccctccaacaccaaactcttagaactagcagaaacaccggacgcatttgacaaagtagca
ctaattttattcatgcaagcaatcttcgcctttgaaaacatgggtctcattaagtttcaa
agcaccaagagttacgatctggtagaaaaatgtgtctggagaggaatttag

KEGG   Saccharomyces cerevisiae (budding yeast): YML065W
Entry
YML065W           CDS       T00005                                 

Gene name
ORC1
Definition
(RefSeq) origin recognition complex subunit 1
  KO
K02603  origin recognition complex subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YML065W (ORC1)
   04113 Meiosis - yeast
    YML065W (ORC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YML065W (ORC1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YML065W (ORC1)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YML065W (ORC1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YML065W (ORC1)
SSDB
Motif
Pfam: AAA_lid_10 BAH AAA AAA_22 AAA_16 ATPase_2 AAA_18 AAA_19 NACHT RNA_helicase DUF3222 SDA1
Other DBs
NCBI-GeneID: 854937
NCBI-ProteinID: NP_013646
SGD: S000004530
UniProt: P54784
LinkDB
Structure
PDB: 

Position
XIII:142210..144954
AA seq 914 aa
MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHN
EAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYN
KLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPT
GEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAE
TRATDITDNEDGNEDESSDYESPSDIDVSEDMDSGEISADELEEEEDEEEDEDEEEKEAR
HTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLLISSCRANNTPVIRKF
TKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFYGNSSELMASRFENKLKTTQKHQIVE
TIFSKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGT
PGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWA
ASMESLEFYFKRVPKNKKKTIVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVAN
TMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRLKGLNDSFFYVDTKTGNAILI
DAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKH
YMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMK
ALNETLNSHVITFMTRLSFTAKLFIYALLNLMKKNGSQEQELGDIVDEIKLLIEVNGSNK
FVMEIAKTLFQQGSDNISEQLRIISWDFVLNQLLDAGILFKQTMKNDRICCVKLNISVEE
AKRAMNEDETLRNL
NT seq 2745 nt   +upstreamnt  +downstreamnt
atggcaaaaacgttgaaggatttacagggttgggagataataacaactgatgagcaggga
aatataatcgatggaggtcagaagagattacgccgaagaggtgcaaaaactgaacattac
ttaaagagaagttctgatggaattaaactaggtcgtggtgatagtgtagtcatgcacaac
gaagccgctgggacttactccgtttatatgatccaggagttgagacttaatacattaaat
aatgttgtcgaactctgggctctcacctatttacgatggtttgaagtcaatcctttagct
cattataggcagtttaatcctgacgctaacattttgaatcgtcctttaaattattacaat
aaactgttttctgaaactgcaaataaaaatgaactgtatctcactgcagaattagccgaa
ttgcagctatttaactttatcagggttgccaacgtaatggatggaagcaaatgggaagta
ttgaaaggaaatgtcgatccagaaagagactttacagttcgttatatttgtgagccgact
ggggagaaatttgtggacattaatattgaggatgtcaaagcttacataaagaaagtggag
ccaagggaagcccaggaatatttgaaagatttaacacttccatcaaagaagaaagagatc
aaaagaggtcctcaaaagaaagataaggctactcaaacggcacaaatttcagacgcagaa
acaagagctacagatataacggataatgaggacggtaatgaagatgaatcatctgattat
gaaagtccgtcagatatcgacgttagcgaggatatggacagcggtgaaatatccgcagat
gagcttgaggaagaagaagacgaagaagaagacgaagacgaagaagagaaagaagctagg
catacaaattcaccaaggaaaagaggccgtaagataaaactaggtaaagatgatattgac
gcttctgtacaacctccccccaaaaaaagaggtcgtaaacctaaagatcctagtaaaccg
cgtcagatgctattgatatcttcatgccgtgcaaataatactcctgtgattaggaaattt
acaaaaaagaatgttgctagggcgaaaaagaaatataccccgttttcgaaaagatttaaa
tctatagctgcaataccagatttaacttcattacctgaattttacggaaattcttcggaa
ttgatggcatcaaggtttgaaaacaaattaaaaacaacccaaaagcatcagattgtagaa
acaattttttctaaagtcaaaaaacagttgaactcttcgtatgtcaaagaagaaatattg
aagtctgcaaatttccaagattatttaccggctagggagaatgaattcgcctcaatttat
ttaagtgcatatagtgccattgagtccgactccgctactactatatacgtggctggtacg
cctggtgtagggaaaactttaaccgtaagggaagtcgtaaaggaactactatcgtcttct
gcacaacgagaaataccagactttctttatgtggaaataaatggattgaaaatggtaaaa
cccacagactgttacgaaactttatggaacaaagtgtcaggagaaaggttaacatgggca
gcttcaatggagtcactagagttttactttaaaagagttccaaaaaataagaagaaaacc
attgtagtcttgttggacgaactcgatgccatggtaacgaaatctcaagatattatgtac
aattttttcaattggactacttacgaaaatgccaaacttattgtcattgcagtagccaat
acaatggacttaccagaacgtcagctaggcaataagattacttcaagaattgggtttacc
agaattatgttcactgggtatacgcacgaagagctaaaaaatatcattgatttaagactg
aaggggttgaacgactcatttttctatgttgatacaaaaactggcaatgctattttgatt
gatgcggctggaaacgacactacagttaagcaaacgttgcctgaagacgtgaggaaagtt
cgcttaagaatgagtgctgatgccattgaaatagcttcgagaaaagtagcaagtgttagt
ggtgatgcaagaagagcattgaaggtttgtaaaagagcagctgaaattgctgaaaaacac
tatatggctaagcatggttatggatatgatggaaagacggttattgaagatgaaaatgag
gagcaaatatacgatgatgaagacaaggatcttattgaaagtaacaaagccaaagacgat
aatgatgacgatgatgacaatgatggggtacaaacagttcacatcacgcacgttatgaaa
gccttaaacgaaactttaaattctcatgtaattacgtttatgacgcgactttcatttaca
gcaaaactgtttatttatgcattattaaacttgatgaaaaagaacggatctcaagagcaa
gaactgggcgatattgtcgatgaaatcaagttacttattgaagtaaatggcagtaataag
tttgtcatggagatagccaaaacattgttccaacagggaagtgataatatttctgaacaa
ttgagaattatatcatgggatttcgttctcaatcagttacttgacgcgggaatattgttt
aaacaaactatgaagaacgatagaatatgttgtgtcaagctaaatatatcagtagaagaa
gccaaaagagccatgaatgaggatgagacattgagaaatttatag

KEGG   Saccharomyces cerevisiae (budding yeast): YNL261W
Entry
YNL261W           CDS       T00005                                 

Gene name
ORC5
Definition
(RefSeq) origin recognition complex subunit 5
  KO
K02607  origin recognition complex subunit 5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YNL261W (ORC5)
   04113 Meiosis - yeast
    YNL261W (ORC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YNL261W (ORC5)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YNL261W (ORC5)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YNL261W (ORC5)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YNL261W (ORC5)
SSDB
Motif
Pfam: ORC5_C AAA_22 AAA_16 AAA_19
Other DBs
NCBI-GeneID: 855460
NCBI-ProteinID: NP_014138
SGD: S000005205
UniProt: P50874
LinkDB
Structure
PDB: 
5ZR1 5V8F

Position
XIV:155100..156539
AA seq 479 aa
MNVTTPEVAFREYQTNCLASYISADPDITPSNLILQGYSGTGKTYTLKKYFNANPNLHAV
WLEPVELVSWKPLLQAIARTVQYKLKTLYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYE
SLQEKTCLFLILDGFDSLQDLDAALFNKYIKLNELLPKDSKINIKFIYTMLETSFLQRYS
THCIPTVMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFI
HLIVQAFHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLS
ENGQGESAITTNRDDLENSQTYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGR
AAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKAESGSLSALREESLMKANIEV
FQNLSELHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYFSDIHE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaatgtgaccactccggaagttgcttttagggaatatcaaaccaactgtctcgcatcg
tatatttctgctgatccagacataactccttcaaatttaatcttgcaaggttatagtgga
acaggaaaaacctacactttgaagaagtattttaatgcgaatccaaatttgcatgcagta
tggctggaacctgttgagttggtttcttggaagcccttactgcaggcgatagcacgtact
gtacaatataaattgaaaaccctatatccaaacattcccaccacagattacgatccttta
caggttgaagagccatttcttttggtaaagacgttgcacaatatttttgtccaatatgaa
tctttgcaagaaaagacttgcttgttcttgatattggatggtttcgatagtttacaagat
ttagacgccgcactgtttaacaaatatatcaaactaaatgaattacttccaaaagattct
aaaattaatataaaattcatttacacgatgttagagacatcatttttgcaaagatattct
acacattgcattccaactgttatgtttccgaggtataatgtggacgaagtttctactata
ttagtgatgtctagatgtggcgaactcatggaagattcttgtctacgtaagcgtatcatt
gaagagcagataacggactgtacagacgatcaatttcaaaatgtagctgcgaacttcatt
cacttaattgtgcaggcttttcattcttatactggaaacgacatattcgcattgaatgac
ttgatagacttcaaatggcccaagtatgtatctcgcattactaaggaaaacatatttgaa
ccactggctctttacaaaagtgccatcaaactatttttaagcacagatgataatttaagt
gaaaatggacaaggtgaaagcgcgataaccacaaatcgtgatgaccttgagaacagtcaa
acttacgacttatcaataatttcgaagtatctgctcatagcctcatatatttgttcatat
ctggaacctagatacgatgcgagtattttctctaggaaaacacgtatcatacaaggtaga
gctgcttatggacgaagaaagaagaaagaagttaaccctagatatttacagccttcttta
tttgctattgaaagacttttggctattttccaagctatattccctattcaaggtaaggcg
gagagtggttccctatctgcacttcgtgaggaatccttaatgaaagcgaatatcgaggtt
tttcaaaatttatccgaattgcatacattgaaattaatagctacaaccatgaacaagaat
atcgactatttgagtcctaaagtcaggtggaaagtaaacgttccctgggaaattattaaa
gaaatatcagaatctgttcatttcaatatcagcgattacttcagcgatattcacgaatga

KEGG   Saccharomyces cerevisiae (budding yeast): YPR162C
Entry
YPR162C           CDS       T00005                                 

Gene name
ORC4
Definition
(RefSeq) origin recognition complex subunit 4
  KO
K02606  origin recognition complex subunit 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YPR162C (ORC4)
   04113 Meiosis - yeast
    YPR162C (ORC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YPR162C (ORC4)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YPR162C (ORC4)
SSDB
Motif
Pfam: ORC4_C AAA_22 AAA_14 AAA
Other DBs
NCBI-GeneID: 856291
NCBI-ProteinID: NP_015488
SGD: S000006366
UniProt: P54791
LinkDB
Structure
PDB: 
5ZR1 5V8F

Position
XVI:complement(866715..868304)
AA seq 529 aa
MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQL
YGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQ
QSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGSEEKIDDTSLETISSGSLTEV
FEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEH
SRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISP
WVSQWNETLEKELSDPRSNLNRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKS
CSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALRAKDGSFNFNLAYAEYEKMIK
AINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDN
ATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgactataagcgaagctcgtctatcaccgcaagtcaatcttctcccaataaagaggcac
tcaaacgaagaggtagaggagactgcagcgattctaaaaaagcgtactatagataatgaa
aagtgtaaagacagcgaccctggttttggttcccttcaaagaaggttactgcagcaactt
tatggcacacttcctacggacgaaaagataatcttcacatatttacaagattgtcaacaa
gagatcgatagaatcattaaacaatccattattcagaaagagagtcattcagtaattctc
gtggggcccagacaaagttacaaaacatacttattagactatgaactgtctttgttgcaa
caatcttataaagagcagtttataactatcaggttgaatgggtttattcactccgaacaa
acagctattaacggtatagcaactcaattggaacagcagttgcagaaaattcatggcagt
gaagaaaaaattgacgatacttcattagagactattagcagtggttctttgacagaagtg
tttgagaaaattcttttactcttagattcgaccacgaagacaagaaatgaagatagtggt
gaggttgacagagagagtataacaaagataacagttgtttttatattcgatgaaattgat
acatttgctgggcctgtgaggcaaactttattatacaatctttttgacatggtagaacat
tctcgggtacctgtttgcatttttggctgcacaacgaaattaaatatcttggaatattta
gaaaagagggtaaagagtagattttctcaaagagtgatttatatgccgcaaatacagaat
ctagacgatatggttgacgccgtcagaaatttacttacagttcgctctgaaatctccccc
tgggtttcacaatggaatgaaacgttggaaaaagaactatccgaccctcgatcgaatttg
aatagacatattaggatgaatttcgaaacctttaggtcattacctacattgaaaaatagc
ataattccattagtagcgacatccaaaaattttggttcactctgcactgccataaaatcg
tgttcttttcttgacatatacaataagaaccaactatctaataatttaacaggaaggctc
caatctttatccgatttagagttagccattttgatctcagccgctagggttgccttaagg
gcgaaagacggatcttttaattttaatttagcttatgcagagtatgaaaagatgattaaa
gctatcaactccagaattcccaccgtggctcctactacaaatgtgggaacaggtcaaagt
actttttctatcgacaatactatcaaactatggttgaaaaaggacgtcaagaacgtttgg
gaaaatttagtgcaactggatttttttaccgagaaatcagccgttggtttgagagataat
gcgaccgcagcattttacgctagcaattatcaatttcagggcaccatgatcccgtttgac
ttgagaagttaccagatgcagatcattcttcaggaattaagaagaattatccccaaatct
aatatgtactactcctggacacaactgtga

DBGET integrated database retrieval system