KEGG   Saccharomyces cerevisiae (budding yeast): YBR160W
Entry
YBR160W           CDS       T00005                                 

Gene name
CDC28, CDK1, HSL5, SRM5
Definition
(RefSeq) cyclin-dependent serine/threonine-protein kinase CDC28
  KO
K04563  cyclin-dependent kinase [EC:2.7.11.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YBR160W (CDC28)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBR160W (CDC28)
   04113 Meiosis - yeast
    YBR160W (CDC28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YBR160W (CDC28)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     YBR160W (CDC28)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     YBR160W (CDC28)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Seadorna_VP7
Other DBs
NCBI-GeneID: 852457
NCBI-ProteinID: NP_009718
SGD: S000000364
UniProt: P00546
LinkDB
Position
II:560078..560974
AA seq 298 aa
MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagcggtgaattagcaaattacaaaagacttgagaaagtcggtgaaggtacatacggt
gttgtttataaagcgttagacttaagacctggccaaggtcaaagagtagtcgcattgaag
aaaataagactagagagtgaagacgagggtgttcccagtacagccatcagagaaatctca
ttattgaaggaattaaaagacgataatattgtcagattatacgatattgttcactctgat
gcacacaagctatatcttgtttttgagttcctcgatttggacctgaaaagatatatggag
ggtattccaaaggaccaaccgttaggagctgatattgttaagaagtttatgatgcaactt
tgtaagggtattgcatactgccactcacaccgtattctgcatcgtgatttaaaaccgcag
aacttattgattaacaaagatgggaatctaaaactaggtgattttggcttagcgcgtgct
tttggtgttccgttgagagcttacacacatgaaattgttactctatggtatagagctccg
gaggtattactgggtggaaaacaatatagtacaggtgtcgatacatggtccatcggctgt
atatttgccgaaatgtgtaacaggaaaccaatcttcagtggcgatagtgagatcgatcag
attttcaagatattcagagtattgggaacgccgaatgaagctatatggccagatattgtc
tacttgcctgatttcaagccaagctttcctcaatggcgcagaaaagacctatcacaagtg
gtaccaagtctagatccacgcggtattgatttgttggacaaactcctcgcgtatgaccct
attaaccggattagcgccagaagagcagccatccacccctacttccaagaatcataa

DBGET integrated database retrieval system